SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000003360 from Monodelphis domestica 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000003360
Domain Number 1 Region: 156-200
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000000000242
Family Classic zinc finger, C2H2 0.0033
Further Details:      
 
Domain Number 2 Region: 189-226
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000000928
Family Classic zinc finger, C2H2 0.0062
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000003360   Gene: ENSMODG00000002760   Transcript: ENSMODT00000003430
Sequence length 243
Comment pep:known_by_projection chromosome:BROADO5:6:96283095:96306682:1 gene:ENSMODG00000002760 transcript:ENSMODT00000003430 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSAAAYMDFVAAQCLVSISNRAAEPEHGAAEAERLRMPEREGTKEHGDPGDTWKDYCTLV
TIAKSLLDLNKYRPLATPSLCSDSIESPDEDLGSDSDVTTESGSSPSHSPEERQDSGGVP
GSLSLLHPGVSAKGKLASEKRHKCPYSGCGKVYGKSSHLKAHYRVHTGERPFPCTWPDCL
KKFSRSDELTRHYRTHTGEKQFRCPLCEKRFMRSDHLTKHARRHTEFHPSMIKRSKKSLA
NPL
Download sequence
Identical sequences F6YH50
ENSMODP00000003360 ENSMODP00000003360 13616.ENSMODP00000003360 XP_001365279.1.35504 XP_020857513.1.61212

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]