SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000003794 from Monodelphis domestica 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000003794
Domain Number 1 Region: 1001-1053
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000000000236
Family Classic zinc finger, C2H2 0.012
Further Details:      
 
Domain Number 2 Region: 255-305
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000000000821
Family Classic zinc finger, C2H2 0.0067
Further Details:      
 
Domain Number 3 Region: 965-1016
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000000303
Family Classic zinc finger, C2H2 0.013
Further Details:      
 
Domain Number 4 Region: 188-240
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000608
Family Classic zinc finger, C2H2 0.021
Further Details:      
 
Domain Number 5 Region: 630-675
Classification Level Classification E-value
Superfamily Homeodomain-like 0.000018
Family Homeodomain 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000003794   Gene: ENSMODG00000003112   Transcript: ENSMODT00000003878
Sequence length 1194
Comment pep:known_by_projection chromosome:BROADO5:4:144642438:144683352:-1 gene:ENSMODG00000003112 transcript:ENSMODT00000003878 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
VVNYDNVVDTGSETDEEDKLHIAEDEGIANTLDQETSPASVVPNHESSPHVSQGLLPRED
EEDDIREGGVEHPWHNNEILQASVDGPEEMKEEYDTMGPEATIQTTVNNGTVKNANCTSD
FEEYFAKRKLDEGDGHAVSIAEYLQRSDTAIIYPEAPEELSRLGTPEANGQEENDLPPGT
PDAFAQLLTCPYCDRGYKRLTSLKEHIKYRHEKNEENFSCPLCSYTFAYRTQLERHMVTH
KPGTDQHQMLTQGAGNRKFKCTECGKAFKYKHHLKEHLRIHSGEKPYECPNCKKRFSHSG
SYSSHISSKKCIGLISVNGRMRNNIKTGSSPNSVSSSPTNSAISQLRNKLENGKPLSMPE
QTGLLKIKTEPLDFNDYKVLMATHGFSSASPFMNGGLGATSPLGVHPSAQSPMQHLGVGM
EAPLLGFPTIGSNLSEVQKVLQIVDNTVSRQKMDCKAEEISKLKGYHMKDPCSQTEEQGV
TSPNIPPVGLPVVSHNGATKSIIDYTLEKVNEAKACLQSLTTDSRRPLSNIKKEKLRTLI
DLVTEDKMIENHNISTPFSCQFCKESFPGPIPLHQHERYLCKMNEEIKAVLQPHESIVPN
KSEMFVDNKALLLSSVLSEKGMTSPINPYKDHMSVLKAYYAMNMEPNSDELLKISIAVGL
PQEFVKEWFEQRKVYQYSNSRSPSLERTSAKVALAATNNTPTKDSLSARSPVKPMDSITS
PSIAELHNSVTNCDTPLRLTKPTHFTNIKPVVDKLDHSRSNTPSPLNLSSTSSKNSHSSS
YTPNSFSSEELQAEPLDLSLPKQMKEPKSIIATKNKTKASSINLDHNSVSLSSENSDEPL
NLTFIKKEFSNSNNLDNKSTNPVFSMNPFSAKPLYTTLPPQSAFPPATFMPPVQTSIPGL
RPYPGLDQMSFLPHMAYTYPTGAATFADMQQRRKYQRKQGFQGELLDGTQDYMSGLDDMT
DSDSCLSRKKIKKTESGMYACDLCDKTFQKSSSLLRHKYEHTGKRPHQCQICKKAFKHKH
HLIEHSRLHSGEKPYQCDKCGKRFSHSGSYSQHMNHRYSYCKREAEEREAAEREAREKGH
LEPTELLMNRAYLQSITPQGYSDSEERESMPRDGESEKEHEKEGEDGYEKLGRQDGDEEF
EEEEEESENKSMDTDPETIRDEEETGDHSMDDSSEDGKMETKSDHEEDNMEDGM
Download sequence
Identical sequences F6S3H0
ENSMODP00000003794 ENSMODP00000003794 13616.ENSMODP00000003794

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]