SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000003799 from Monodelphis domestica 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000003799
Domain Number 1 Region: 601-658
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.98e-27
Family Classic zinc finger, C2H2 0.0033
Further Details:      
 
Domain Number 2 Region: 489-546
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 4.95e-27
Family Classic zinc finger, C2H2 0.0031
Further Details:      
 
Domain Number 3 Region: 657-714
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2e-26
Family Classic zinc finger, C2H2 0.0047
Further Details:      
 
Domain Number 4 Region: 265-322
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 5.03e-26
Family Classic zinc finger, C2H2 0.0042
Further Details:      
 
Domain Number 5 Region: 433-490
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 5.74e-26
Family Classic zinc finger, C2H2 0.0032
Further Details:      
 
Domain Number 6 Region: 545-602
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 9.75e-26
Family Classic zinc finger, C2H2 0.0046
Further Details:      
 
Domain Number 7 Region: 713-770
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.32e-25
Family Classic zinc finger, C2H2 0.006
Further Details:      
 
Domain Number 8 Region: 321-378
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.71e-25
Family Classic zinc finger, C2H2 0.0048
Further Details:      
 
Domain Number 9 Region: 210-266
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 5.83e-23
Family Classic zinc finger, C2H2 0.0047
Further Details:      
 
Domain Number 10 Region: 377-434
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.43e-22
Family Classic zinc finger, C2H2 0.0038
Further Details:      
 
Domain Number 11 Region: 759-811
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.38e-21
Family Classic zinc finger, C2H2 0.004
Further Details:      
 
Domain Number 12 Region: 9-69
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 2.48e-20
Family KRAB domain (Kruppel-associated box) 0.001
Further Details:      
 
Weak hits

Sequence:  ENSMODP00000003799
Domain Number - Region: 184-223
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00915
Family Classic zinc finger, C2H2 0.027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000003799   Gene: ENSMODG00000025016   Transcript: ENSMODT00000003883
Sequence length 818
Comment pep:novel chromosome:BROADO5:3:144768547:144787075:1 gene:ENSMODG00000025016 transcript:ENSMODT00000003883 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAFERDRLPAQEELTFKDVAVDFTREEWHLLSPSQKKLYKEVMLENARNLLSVGLLAPPE
VLLSSLEQRNAPWMLEQEVPGRKIGDPESKLLSVKEERISLTSKRLSLDARTSNQLQGKL
ITQHSKMSEHLACCQPESSLQGKRKRQPVTRCPASRFGLSCQDFRFMSDGPNNFAFKEFC
VAPQHSSYIEHQRTHSEETFSESNQSQKIFMHRANIAGHQNIHTGEKPYECKLCGKTFSQ
SSSLAYHQRIHTGKKPYECKQCGKTFGMSSSLAVHQRVHTGEKPYECNQCGKTFSRRDNL
AVHQRIHTGEKPYECKQCGKTFSQSSSLAYHQRIHTGKKPYECKQCGKTFGLSSSLAVHQ
RIHTGEKPYECKQCGKTFSMSSYLAVHQRTHTGEKPHGCNQCGKTFSRRDKLAVHQRIHT
GEKLSECKQCGKTFTNNSSLVIHQKIHTGEKPYECKQCRKTFSRSSNLVIHQRIHTGEKP
YECNQCGKAFSMSSSLAAHQKIHTGEKPYECKQCGKTFSRSSNLVIHQRIHTGEKPYECN
QCGKAFSMSSSFAVHQKIHTGEKPYECNQCGKTFSMSSSLTAHQRIHTGEKPYGCNQCGK
AFSQSSSLAVHQKIHTGEKPYECKQCGKTFSRNSNLVIHQRIHTGEKPYECNQCGKTFSM
NSSLTVHQKIHTGEKPYECNQCGKAFSMSSSLAIHQRTHTGEKPYECKQCGKAFSMSSSL
AIHQRTHTGEKPYECKQCGKTFTVYSTLAVHQRIHTGEKPYECNKCGKTFNRSSNLVIHQ
RIHTGEKPYKCNRCGKAFSMSSSLAVHQRIHTAEKPYE
Download sequence
Identical sequences F6S3D7
ENSMODP00000003799 ENSMODP00000003799

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]