SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000003813 from Monodelphis domestica 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000003813
Domain Number 1 Region: 722-757
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000567
Family Classic zinc finger, C2H2 0.018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000003813   Gene: ENSMODG00000003128   Transcript: ENSMODT00000003897
Sequence length 792
Comment pep:known_by_projection chromosome:BROADO5:7:75617782:75620505:-1 gene:ENSMODG00000003128 transcript:ENSMODT00000003897 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEVFPELRKQPELLECDHCSFKGTDYENVQIHMGTIHPEYCDEMDAGGLGKMIFYQKTAK
LFHCHKCFFTSKMYCNVYYHITSQHSVKDKWDDKQKKQLEETEPVKTSLFPESQKMSNSS
EIQKSTPVFSAELQKPAPIQTPESPQTTPASSPELQKPASGVSAEPQKPVIPDSQKPSPV
PSPESPELVPLASLEQQKLASVSPEPQKSPVVNPSTQKLSHFTETLRTPLSTSPEPQEPV
LASSPEPWGSSPSSSPESQKPALTESPEPRRPSPAVSPESWKPSPAVSPEPRRPAPSVSP
GPWKPVVSTSPRPWKPAPSTSPGSWKTAKPAPSVSPGPWKPLPLSPGPWKPSPPMSPGSW
KPLPVSPGSWKANTSPEAWKPGPPELRKTSPMSPELWKAGPPLSPELRMPGPPLSPESRK
PGPPLSPELRKPEIRKAIPSLSPDLRKSGPPVLSDLRKPGPPLSPDLRKSGSSLSPDHQK
SSVSPELWKVSSDQWKPSISGEPWKPVSNDFTESQKTVSPGSPDVWKSSFFLEPQKPVFP
ESRKRILFPESRKHTPFSELPKSISLYPESQKLVESSEYDIQTEALEDQKDDILAQEEAL
YHCQKKFKKDNQENSDAELSSSECGKADLDFFDLKGQESNSDQEQVDVESVDFTRENKMD
PSDQPKSILQFTDDKEAFISEEEIAKYMKRGKGKYFCKICCCRAMKKGAVLHHLVNKHNV
HSPYKCTICGKAFLLESLLKNHVAAHGQSLLKCPRCNFESNFPRGFKKHLTHCQNRHNEE
VNKKLMEAIEPP
Download sequence
Identical sequences F6WV14
13616.ENSMODP00000003813 ENSMODP00000003813 ENSMODP00000003813

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]