SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000003932 from Monodelphis domestica 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000003932
Domain Number 1 Region: 207-330
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 7.62e-36
Family DEP domain 0.0000206
Further Details:      
 
Domain Number 2 Region: 31-139
Classification Level Classification E-value
Superfamily PDZ domain-like 1.14e-23
Family PDZ domain 0.0000314
Further Details:      
 
Weak hits

Sequence:  ENSMODP00000003932
Domain Number - Region: 318-372
Classification Level Classification E-value
Superfamily beta-sandwich domain of Sec23/24 0.0654
Family beta-sandwich domain of Sec23/24 0.063
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000003932   Gene: ENSMODG00000003229   Transcript: ENSMODT00000004018
Sequence length 516
Comment pep:known_by_projection chromosome:BROADO5:2:537800620:537807452:1 gene:ENSMODG00000003229 transcript:ENSMODT00000004018 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
RFSSSTEQSSASRLMRRHKRRRRKQKVARIERSSSFSSITDSTMSLNIITVTLNMEKYNF
LGISIVGQSNERGDGGIYIGSIMKGGAVAADGRIEPGDMLLQVNDINFENMSNDDAVRVL
REIVHKPGPITLTVAKCWDPSPRGCFTLPRSEPIRPIDPAAWVSHTAAMTGTFPAYGMSP
SLSTITSTSSSIASSIPDTERLDDFHLSIHSDMATIVKAMASPESGLEVRDRMWLKITIP
NAFIGSDVVDWLYHNVEGFTDRREARKYASNLLKAGFIRHTVNKITFSEQCYYIFGDLCG
NMANLSLHDQDGSSGASDQDTLAPLPHPGAAPWPMAFPYQYPPPPHPYNPHPGFPEPGYS
YGGGGSAGSQHSEGSRSSGSNRSGSDRRKEKDPKAGDSKSGGSGSESDHTSRSSLRRERA
PSERSGPAASEHSVRSHHSLAHSLRSHHTHQSYGPPGVPPLYGPPVLMMPPPPAAMGPPG
APPGRDLASVPPELTASRQSFRMAMGNPSEFFVDVM
Download sequence
Identical sequences F6TYA8
ENSMODP00000003932 ENSMODP00000003932 13616.ENSMODP00000003932

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]