SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000003939 from Monodelphis domestica 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000003939
Domain Number 1 Region: 163-217
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 6.61e-21
Family Classic zinc finger, C2H2 0.0031
Further Details:      
 
Domain Number 2 Region: 298-355
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 5.69e-19
Family Classic zinc finger, C2H2 0.007
Further Details:      
 
Domain Number 3 Region: 217-272
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 7.34e-19
Family Classic zinc finger, C2H2 0.0052
Further Details:      
 
Domain Number 4 Region: 88-142
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 4.58e-17
Family Classic zinc finger, C2H2 0.0062
Further Details:      
 
Domain Number 5 Region: 41-85
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000216
Family Classic zinc finger, C2H2 0.025
Further Details:      
 
Domain Number 6 Region: 347-376
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000405
Family Classic zinc finger, C2H2 0.017
Further Details:      
 
Weak hits

Sequence:  ENSMODP00000003939
Domain Number - Region: 149-168
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000405
Family Classic zinc finger, C2H2 0.0081
Further Details:      
 
Domain Number - Region: 266-287
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00468
Family Classic zinc finger, C2H2 0.019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000003939   Gene: ENSMODG00000003236   Transcript: ENSMODT00000004025
Sequence length 376
Comment pep:novel chromosome:BROADO5:Un:74217691:74218937:-1 gene:ENSMODG00000003236 transcript:ENSMODT00000004025 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
YKIRICECDIYGKNFLHKSSIRHCNKNVCKTEFNYSSALCNKIATGEKSWKHNEFEEAFL
HSKFLTQHQGMCTGGKHYKCKECGKVLSKSSLKLHQRVDTGEKPYECNESGKGFNDGSSP
TKHQRIHTGDKPYTCSDSGTSFIDCSSLAEKPYKCSECGAAFTHSHPLLHQRIHTGEKPF
NCNECGKAFRQNALLILHQKMHTGEKPYEWSGCGKAFGDSSSFTKHQSIHTGEKPNKCND
CRKSFSDSSSFTRHQRIHTGEKLYKCTCGKSFSDSSSLSHHQRIHPGKPFKCNECGYTYR
QNALLVLHLRVHTGEKPYECSRCGKAFSSSSSLMKHQRICIGPKSYKFIDCGKSFNDSLS
SQHQKIHTEEKPYQCN
Download sequence
Identical sequences H9H627
13616.ENSMODP00000003939 ENSMODP00000003939 ENSMODP00000003939

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]