SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000003943 from Monodelphis domestica 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000003943
Domain Number 1 Region: 13-196
Classification Level Classification E-value
Superfamily SET domain 1.09e-26
Family Histone lysine methyltransferases 0.065
Further Details:      
 
Weak hits

Sequence:  ENSMODP00000003943
Domain Number - Region: 276-344
Classification Level Classification E-value
Superfamily TPR-like 0.000123
Family Tetratricopeptide repeat (TPR) 0.05
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000003943   Gene: ENSMODG00000003237   Transcript: ENSMODT00000004029
Sequence length 366
Comment pep:known_by_projection chromosome:BROADO5:2:123092057:123136210:1 gene:ENSMODG00000003237 transcript:ENSMODT00000004029 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLPRKESIKEKKKEDWPMHKLECSAMCVFGENWNPSETVRLTARILAKQKTHHERTSSEK
LLAVKEFESHLDKLDNEKRELIQSDIAALHHFYSKHLEYPDNCSLVTLFAQVNCNGFTIE
DEELSHLGSAIFPDVALMNHSCCPNVIVTYKGTLAEVRAVQEINPGDEVFTSYIDLLYPT
EDRNDRLKDSYFFTCECRECTTKAKDKAKVEIRKLSEPPKAEDIRDMVKYARNVIEEFRR
AKHYKSPSELLEICELSQEKMSSLFEDSNVYMLHMMYQAMGVCLYMQDWEGALRYGQKII
KPYSKHYPLYSLNVASMWLKLGRLYMGLEHKASGVKALKKAIVIMEVAHGKDHPYISEIK
KEIEDH
Download sequence
Identical sequences F6THW6
ENSMODP00000003943 ENSMODP00000003943

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]