SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000004018 from Monodelphis domestica 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000004018
Domain Number 1 Region: 45-136
Classification Level Classification E-value
Superfamily Retrovirus capsid dimerization domain-like 2.01e-40
Family SCAN domain 0.0000449
Further Details:      
 
Domain Number 2 Region: 261-317
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.48e-27
Family Classic zinc finger, C2H2 0.0017
Further Details:      
 
Domain Number 3 Region: 302-354
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.58e-22
Family Classic zinc finger, C2H2 0.0025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000004018   Gene: ENSMODG00000003288   Transcript: ENSMODT00000004104
Sequence length 371
Comment pep:known_by_projection chromosome:BROADO5:2:261743317:261748788:-1 gene:ENSMODG00000003288 transcript:ENSMODT00000004104 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSAVLSEDSVLISPSLTEKESILRVKIEEDHTYGQGSSVHWNRRHGPEIFRQQFRQFGYQ
DSPGPREALSQLRQLCRLWLRPERHTKEQILELLVLEQFLTILPKELQTWVREHHPENGE
EAVTILEDLERELDEPGHQVSFSGQAQEDFIEEMESQETTEESSNIRPLPMENELKWEAW
EFHPLRHSDGDPQTENGKSSSNQEIYSGIEPQDDISGTLNIDVAQIFKYGEIYQREVRFE
RKQGNPSRKKQHKCDECGKLFSQSSALILHQRIHSGEKPYECDECGKAFSRSSILIQHQR
IHTGEKPYKCHECGKAFSQNSGLINHQRIHTGEKPYECSECGKAYSQSSNLFRHQRRHSG
EKILSMCKNIL
Download sequence
Identical sequences F7EG80
XP_007483445.1.35504 XP_007483446.1.35504 XP_007483447.1.35504 XP_016286385.1.35504 ENSMODP00000004018 ENSMODP00000004018

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]