SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000004051 from Monodelphis domestica 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000004051
Domain Number 1 Region: 57-114
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 5.96e-27
Family Classic zinc finger, C2H2 0.0034
Further Details:      
 
Domain Number 2 Region: 309-366
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 6.79e-27
Family Classic zinc finger, C2H2 0.0049
Further Details:      
 
Domain Number 3 Region: 141-198
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 8.85e-27
Family Classic zinc finger, C2H2 0.0038
Further Details:      
 
Domain Number 4 Region: 226-282
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 7.17e-26
Family Classic zinc finger, C2H2 0.0038
Further Details:      
 
Domain Number 5 Region: 353-413
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 8.7e-23
Family Classic zinc finger, C2H2 0.0042
Further Details:      
 
Domain Number 6 Region: 1-58
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.85e-22
Family Classic zinc finger, C2H2 0.0062
Further Details:      
 
Domain Number 7 Region: 272-304
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000000281
Family Classic zinc finger, C2H2 0.0067
Further Details:      
 
Domain Number 8 Region: 188-220
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000000584
Family Classic zinc finger, C2H2 0.0091
Further Details:      
 
Domain Number 9 Region: 104-136
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000000597
Family Classic zinc finger, C2H2 0.0051
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000004051   Gene: ENSMODG00000023646   Transcript: ENSMODT00000004137
Sequence length 415
Comment pep:novel chromosome:BROADO5:3:502236181:502237425:1 gene:ENSMODG00000023646 transcript:ENSMODT00000004137 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
TFMHRASPPGHERMHTGEKLFECKQCGKTFSRSSHLAVHQRIHTGEKPYECKQCGKSFTD
KSSLAKHQRIHTGEKPYECKQCGKTFSRSSHLAVHQRIHTGEKPYECKECGKSFSRSSSV
FLHQRIHTGEKPYECNQCGKTFIDKSSLVKHQRIHTGEKPYECKQCGKAFRNSTNLVVHQ
RIHTGEKPYECKECGKTFLRSSQLGVHQRIHTGEKPYECKQCGKIFTVKSHLSVHQRIHT
GEKPYECKQCGKTFTNNSHLVVHWRIHTGEKPYECKQCGKTFTNNSHLVVHWRIHTGEKP
YECKQCGKTFRRSSHLAVHQRIHTGEKPYECKQCGKTFINNSHLAVHQRIHTGEKPYECN
QCGKAFKERFKLTVHQRIHTGEKPYECKKCGKIFICSSNLAVHQRIHTGEKPYEC
Download sequence
Identical sequences F7DYL1
ENSMODP00000004051 13616.ENSMODP00000004051 ENSMODP00000004051

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]