SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000004151 from Monodelphis domestica 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000004151
Domain Number 1 Region: 4-112
Classification Level Classification E-value
Superfamily POZ domain 1.45e-30
Family BTB/POZ domain 0.00045
Further Details:      
 
Domain Number 2 Region: 527-583
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.68e-22
Family Classic zinc finger, C2H2 0.0079
Further Details:      
 
Domain Number 3 Region: 387-443
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.12e-19
Family Classic zinc finger, C2H2 0.012
Further Details:      
 
Domain Number 4 Region: 471-527
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 6.42e-18
Family Classic zinc finger, C2H2 0.013
Further Details:      
 
Domain Number 5 Region: 568-620
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 7.04e-17
Family Classic zinc finger, C2H2 0.0069
Further Details:      
 
Domain Number 6 Region: 344-396
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000000000246
Family Classic zinc finger, C2H2 0.013
Further Details:      
 
Domain Number 7 Region: 600-654
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000000000106
Family Classic zinc finger, C2H2 0.015
Further Details:      
 
Domain Number 8 Region: 321-353
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000000756
Family Classic zinc finger, C2H2 0.014
Further Details:      
 
Domain Number 9 Region: 433-465
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000196
Family Classic zinc finger, C2H2 0.018
Further Details:      
 
Domain Number 10 Region: 734-761
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000412
Family Classic zinc finger, C2H2 0.027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000004151   Gene: ENSMODG00000003391   Transcript: ENSMODT00000004238
Sequence length 816
Comment pep:known_by_projection chromosome:BROADO5:4:375522563:375576043:1 gene:ENSMODG00000003391 transcript:ENSMODT00000004238 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAAMDFPQHSQLVLEQLNQQRQLGLLCDCTFVVDGINFKAHKAVLAACSEYFKMLFVDQK
DVVHLDISNAAGLGQVLEFMYTAKLSLSPENVEDVLAVAGFLQMQDIVSACNALRSLPVT
TSSTLEKQEPPEPEGEDKKMDEEKKVAAATLSELDRVEYIPPAEPGGGMKGEPEAQVENR
GDGLGAKEEKEATSKESLPTETRPSSVGTPLEVLVSRRSQQEGETEIQRNEAAHPKGPAE
MEAEPVKEDEEQDSSQEAALLGKSSTTEENRPPLENGGSATEENEESGGTDSGQENVGEA
RVLRSGTYSDRTESKAYGSVIHKCEDCGKEFTHTGNFKRHIRIHTGEKPFSCRECNKAFS
DPAACKAHEKTHSPLKPYGCEECGKSYRLISLLNLHKKRHTGEARYRCGDCGKLFTTSGN
LKRHQLVHSGEKPYQCDYCGRSFSDPTSKMRHLETHDTDKEHKCPHCDKKFNQVGNLKAH
LKIHIADGPLKCRECGKQFTTSGNLKRHLRIHSGEKPYVCVHCQRQFADPGALQRHVRIH
TGEKPCQCLICGKAFTQASSLIAHVRQHTGEKPYVCERCGKRFVQSSQLANHIRHHDNIR
PHKCSVCSKAFVNVGDLSKHIIIHTGEKPFLCDKCGRGFNRVDNLRSHVKTVHQGKAGIK
IMEPDEGDEVNIVTVASDDMVTLATEALAATAVTQLTVVPVGAAVTADETEALKAEITKA
VKQVQEADPNTQILYACDSCGEKFLDANSLAQHVRIHTAQALVMFQADTDFYQQYGPGST
WQAEQVLQAGELLFRPREGTEGQPTLAEPPPPTVAE
Download sequence
Identical sequences F6Z143
ENSMODP00000004151 XP_007491723.1.35504 ENSMODP00000004151

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]