SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000004169 from Monodelphis domestica 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000004169
Domain Number 1 Region: 22-71
Classification Level Classification E-value
Superfamily Cysteine-rich DNA binding domain, (DM domain) 7.72e-19
Family Cysteine-rich DNA binding domain, (DM domain) 0.00026
Further Details:      
 
Domain Number 2 Region: 257-303
Classification Level Classification E-value
Superfamily UBA-like 0.000000104
Family CUE domain 0.061
Further Details:      
 
Domain Number 3 Region: 95-148
Classification Level Classification E-value
Superfamily beta-sandwich domain of Sec23/24 0.0000262
Family beta-sandwich domain of Sec23/24 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000004169   Gene: ENSMODG00000003407   Transcript: ENSMODT00000004257
Sequence length 486
Comment pep:known_by_projection chromosome:BROADO5:6:99786003:99809221:1 gene:ENSMODG00000003407 transcript:ENSMODT00000004257 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MNGYGSPYLYMGGPVSQPPRAPLQRTPKCARCRNHGVLSWLKGHKRYCRFKDCTCEKCIL
IIERQRVMAAQVALRRQQANESLESLIPDSLRALPGPPPQPPGDSGAPPQQQQPPPQPQQ
PQQPQAPQQQPPPPRPAELAAAAAALRWASEPQPGSGLQGQLSKADLTEERLGDSSAADN
PEVYSDKDTDQRSSPDMTKSKTCFTPESPEIVSVDEGGYAIQKNGGTTESRADSPKYHSE
QNHLLIEGPSGTVSLPFSLKANRPPLEVLKKIFPNQKPTVLELILKGCGGDLVSAVEVLL
SSRSSVTGADRTSAESESLVLPSNGHIFEHTLSSYPLSSSKWSVGSAFRVPDTLRFSTDS
SNVVPNPLAVPLQHPFPQPPRYPLMLRNTLARNQSSPFLPNDVTLWNTMTLQQQYQLRSQ
YVSPFSSNSTSVFRSSPVLPTRTPEDPRISIPDDGCPIVSKQPIYTEDDYDERSDSSDSR
ILNTSS
Download sequence
Identical sequences F7GL20
ENSMODP00000004169 XP_001365681.1.35504 ENSMODP00000004169

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]