SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000004216 from Monodelphis domestica 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000004216
Domain Number 1 Region: 201-257
Classification Level Classification E-value
Superfamily RING/U-box 0.0000000000000847
Family Variant RING domain 0.026
Further Details:      
 
Weak hits

Sequence:  ENSMODP00000004216
Domain Number - Region: 97-107,354-364
Classification Level Classification E-value
Superfamily Formin homology 2 domain (FH2 domain) 0.000837
Family Formin homology 2 domain (FH2 domain) 0.035
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000004216   Gene: ENSMODG00000003445   Transcript: ENSMODT00000004304
Sequence length 439
Comment pep:known_by_projection chromosome:BROADO5:3:114663002:114807838:-1 gene:ENSMODG00000003445 transcript:ENSMODT00000004304 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSLGGGNSSRRRRAESGDPEPLPLPLPPPPGEPATAGPPRYLPPLPPPLPALPALPPPPQ
APLGPAPKQIEPQPLAEGIPRRGPGEDLPPLPSQPSPPPPLPPPLPPLLPPPPQPQLPLL
LPLPLPSVEQEPSTAGDSGEGFSEPLPPEAVIRDSEEPQAARVGGEAEGQSSEEHPETRS
VCSSRSSSSSSDQRTGHHQHQHHQPICKICFQGAEQGELLNPCRCDGSVRYTHQLCLLKW
ISERGSWTCELCCYRYHVIAIKMKKPCQWQSISITLVEKVQMIAVILGSLFLIASVTWLL
WSAFSPYAVWQRKDILFQICYGMYGFMDLVCIGLIVHEGAAVYRVFKRWRAVNLHWDVLN
YDKATDIEESSRGESSTSRTLWLPLTALRNRNLVHPTQLTSPRFQCGYVLLHLFNRMRPH
EDLSEDNSSGEVVMRVTSV
Download sequence
Identical sequences F7DWW8
ENSMODP00000004216 XP_001373305.1.35504 ENSMODP00000004216

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]