SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000004232 from Monodelphis domestica 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000004232
Domain Number 1 Region: 223-333
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000000088
Family Classic zinc finger, C2H2 0.07
Further Details:      
 
Domain Number 2 Region: 56-98
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000000621
Family Classic zinc finger, C2H2 0.073
Further Details:      
 
Domain Number 3 Region: 3-37
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000134
Family Plant C2H2 finger (QALGGH zinc finger) 0.078
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000004232   Gene: ENSMODG00000003459   Transcript: ENSMODT00000004321
Sequence length 467
Comment pep:known_by_projection chromosome:BROADO5:3:115102024:115132043:-1 gene:ENSMODG00000003459 transcript:ENSMODT00000004321 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MASYTCITCRVAFKDADIQRAHYKSDWHRYNLKRKVADMAPVTAENFQERVLAQRAVAEE
ESKGTATYCTVCSKKFATFNAYENHLKSRRHLELEKKAVQAVSRKVEMLNEKNLEKGLAP
DGLDKDAMNSAIQQAIKAQPSMSPRKVAPAPGVARSRVAATGGPQTLDRDPAEKAPRLQW
FEQQKKKLAKQQGESEEEDEDMEGDDWEDIDSDEEMDSEGAEEQDEVDEVKENPPPGAIP
VTDCLFCSHHSSSLMKNVAHMTKFHSFFIPDIEYLSDLRGLIKYLGEKVGVGKICLWCNE
KGKSFYSTEAVQAHMNDKSHCKLFTEGDAALEFADFYDFRSSYPDHKESEDTEVSEELPL
EKNLEYDDETMELILPSGARVGHRSLMRYYKQRFGLSRAVTTAKNQKAVGRVLQQYRALG
WTGSTGANLLRGRDMQYVQRMKSKWMLKTGMSNNATKQMHYRAQVMF
Download sequence
Identical sequences F7DCD4
ENSMODP00000004232 13616.ENSMODP00000004232 XP_003340644.1.35504 ENSMODP00000004232

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]