SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000004255 from Monodelphis domestica 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000004255
Domain Number 1 Region: 416-468
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000000000224
Family Classic zinc finger, C2H2 0.015
Further Details:      
 
Domain Number 2 Region: 390-426
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000144
Family Classic zinc finger, C2H2 0.0082
Further Details:      
 
Weak hits

Sequence:  ENSMODP00000004255
Domain Number - Region: 361-385
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000489
Family Classic zinc finger, C2H2 0.021
Further Details:      
 
Domain Number - Region: 477-503
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00103
Family Classic zinc finger, C2H2 0.041
Further Details:      
 
Domain Number - Region: 3-77
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.00527
Family LIM domain 0.042
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000004255   Gene: ENSMODG00000003479   Transcript: ENSMODT00000004345
Sequence length 540
Comment pep:known_by_projection chromosome:BROADO5:1:698046490:698056004:1 gene:ENSMODG00000003479 transcript:ENSMODT00000004345 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGYCRLCHGKFSSRSLRHIFGRGPGESCEKQRRMEQAFFMDFKRLLGVPIRQDPALPQFV
CKNCHAQFYKCHSILKSFLQRVNTSPTGHRKPRGNTEEGSQAEAEEGACLVDLITSSPQC
LHRLVGWAHGHAASCGAVPSLQNMLSSEYCGIIQAVWGCDQGHDYVMDTDSNCSSLLLDS
TLAVKWEWDRETAHRLSNNSGTKPPAAVLQSPRSKGTTVPAGAESQSLPNTNEAQPPLDD
NPVGPEPDSPPEPSQPLSGVQGQLSVKQVSSSALDDRVKDEFSDLSEGDFLSDDENDKRK
NTQSSDESFEPYPEKKVSGKVSDSKEVKKSDEPKIRKKPGPKPGWKKKIKCEREELPTIY
KCPYQGCTAVYRGADGMKKHIKEHHEEVRERPCPHPGCNKVFMIDRYLQRHVKLIHTEVR
NYICDECGQTFKQRKHLSVHQMRHSGAKPLQCEICGFQCRQRASLKYHMTKHKAETELEF
ACDQCGRRFEKAHNLNVHMSMVHPLTQNQDKAKPLQNEQPTGLMNPSGTMESQAVKPELV
Download sequence
Identical sequences F7DBN7
13616.ENSMODP00000004255 ENSMODP00000004255 ENSMODP00000004255

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]