SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000004315 from Monodelphis domestica 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000004315
Domain Number 1 Region: 215-272
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.15e-26
Family Classic zinc finger, C2H2 0.0064
Further Details:      
 
Domain Number 2 Region: 299-356
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3e-25
Family Classic zinc finger, C2H2 0.0055
Further Details:      
 
Domain Number 3 Region: 439-496
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.63e-24
Family Classic zinc finger, C2H2 0.0056
Further Details:      
 
Domain Number 4 Region: 355-412
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.73e-22
Family Classic zinc finger, C2H2 0.0064
Further Details:      
 
Domain Number 5 Region: 495-546
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.56e-20
Family Classic zinc finger, C2H2 0.0036
Further Details:      
 
Domain Number 6 Region: 2-44
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 1.16e-16
Family KRAB domain (Kruppel-associated box) 0.0011
Further Details:      
 
Domain Number 7 Region: 185-229
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000000000323
Family Classic zinc finger, C2H2 0.0074
Further Details:      
 
Domain Number 8 Region: 262-293
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000000069
Family Classic zinc finger, C2H2 0.0059
Further Details:      
 
Domain Number 9 Region: 402-434
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000573
Family Classic zinc finger, C2H2 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000004315   Gene: ENSMODG00000003755   Transcript: ENSMODT00000004406
Sequence length 546
Comment pep:novel chromosome:BROADO5:3:503944413:503950168:-1 gene:ENSMODG00000003755 transcript:ENSMODT00000004406 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
SITFKDVALDFTQEEWCLLDHFQKELYLEVMLENVQNLLSVEIRRKLEVNCTQRSGLNRG
LVSNTLLCMNKGPHDFILRETCDSTVKENKIEKRHCEIDETAAKFSQYSVLTQYMKLSSG
NDCSQDSKYRKWFPEDVGFIQSPVKHEMLVYQGNTGGMDFGCSLDSIRHPKINPVEMVSV
NNKGGRCFSQKFKLAAHQRIHTREKPHECKHCGRAFTQRSNLITHQKIHTGEKPFKCQQC
GKAFTQRSNLISHQSIHTGEKPYECQQCGKAFTQRSSLATHHKIHTGEKPYACLHCEKAF
TKRSHLIRHQSIHTGEKPYECQQCGKAFTQRSSLATHQRIHIGEKPYECKHCGKAFIEKG
SLAKHQSIHIGEKPYKCQQCGKAFTQRSSLATHQRNHTGEKPYVCLYCEKAFTKRSHLIT
HQSIHTGENLYECQQCGKAFTQRSSLATHQRIHTGEKPYECKHCGKAFIEKGSLAKHQSI
HTGEKPYECKHCGKAFTHRSNLVSHQRIHTGEKPYGCQHCGKNFTQRGHLIAHQRIHTGE
KSYECQ
Download sequence
Identical sequences F7GBS1
13616.ENSMODP00000004315 ENSMODP00000004315 ENSMODP00000004315

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]