SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000004419 from Monodelphis domestica 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000004419
Domain Number 1 Region: 294-346
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 5.54e-19
Family Classic zinc finger, C2H2 0.005
Further Details:      
 
Domain Number 2 Region: 450-501
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000000000656
Family Classic zinc finger, C2H2 0.0047
Further Details:      
 
Domain Number 3 Region: 269-303
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000000356
Family Classic zinc finger, C2H2 0.014
Further Details:      
 
Domain Number 4 Region: 183-237
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000176
Family Classic zinc finger, C2H2 0.037
Further Details:      
 
Domain Number 5 Region: 92-142
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000209
Family Classic zinc finger, C2H2 0.019
Further Details:      
 
Domain Number 6 Region: 151-194
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000083
Family Classic zinc finger, C2H2 0.054
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000004419   Gene: ENSMODG00000003616   Transcript: ENSMODT00000004514
Sequence length 510
Comment pep:known_by_projection chromosome:BROADO5:8:214828399:214863556:1 gene:ENSMODG00000003616 transcript:ENSMODT00000004514 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MFLLIGSPGEEPCGSGGQLSAGGSRVLRNTTGQGPLLERRCRRPLAMGPSRARLFPGSFQ
ESLQRSGKDIRRIKLEGAVAGSPGGLFQGGAYRCARCGRHFPVWAALRHHTRRRHGRPPL
PCPECGRRFHHAPFLALHQLAHSAATAVSPDTSFFCQVCGQSFKSWAALAMHGQAHASSA
RAVACPKCEKRFSRASQLRAHLRKNHPPAPPPRRFICSGCGQSFAQWAELVAHKQIHVAE
AQASEKALAPRPRGRPALTAAQPGGDAADRPFQCAWCGKCFRHKPNLIAHRRVHTGERPH
QCPECGKRFTNKPYLTSHRRIHTGEKPYPCTECGRRFRHKPNLLSHGKIHRRPQGSMEAT
SSHGSFQLPSQLLEAQQDQATDFQQDQAIDPQQDQAMNLQQDQALDSQQDQAMNPQQDQA
LDSEQDHILDPQQDQGMNLLQDREMDPAAPYGYDECGRTFRHRRSLRAQQQLHPGERPFI
CSECGKNFSKKTHLVAHIRIHSGHPTFLVL
Download sequence
Identical sequences F7C6E4
ENSMODP00000004419 ENSMODP00000004419

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]