SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000004453 from Monodelphis domestica 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000004453
Domain Number 1 Region: 11-68
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.26e-27
Family Classic zinc finger, C2H2 0.0048
Further Details:      
 
Domain Number 2 Region: 227-284
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.05e-26
Family Classic zinc finger, C2H2 0.0072
Further Details:      
 
Domain Number 3 Region: 171-228
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.07e-25
Family Classic zinc finger, C2H2 0.0065
Further Details:      
 
Domain Number 4 Region: 451-508
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.71e-25
Family Classic zinc finger, C2H2 0.01
Further Details:      
 
Domain Number 5 Region: 395-452
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.76e-25
Family Classic zinc finger, C2H2 0.0055
Further Details:      
 
Domain Number 6 Region: 68-124
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.79e-25
Family Classic zinc finger, C2H2 0.006
Further Details:      
 
Domain Number 7 Region: 339-396
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 5e-25
Family Classic zinc finger, C2H2 0.0046
Further Details:      
 
Domain Number 8 Region: 507-564
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 7.95e-25
Family Classic zinc finger, C2H2 0.0054
Further Details:      
 
Domain Number 9 Region: 283-340
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 5.47e-24
Family Classic zinc finger, C2H2 0.0056
Further Details:      
 
Domain Number 10 Region: 553-605
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.6e-22
Family Classic zinc finger, C2H2 0.0038
Further Details:      
 
Domain Number 11 Region: 129-181
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.7e-17
Family Classic zinc finger, C2H2 0.0093
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000004453   Gene: ENSMODG00000003640   Transcript: ENSMODT00000004549
Sequence length 612
Comment pep:novel chromosome:BROADO5:2:540159499:540161442:-1 gene:ENSMODG00000003640 transcript:ENSMODT00000004549 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
KPYECNLCGKAFSQKSHLTVHQRIHTGEKPFECNQCGKTFSQKSHLTVHQRIHTGEKPFE
CNQCGKAFRGRNGLILHQRIHTGQKPFDCNQCGKTFSQKSSLTVHQRIHTGEKPYECNQC
GKAFTQKIHTGEKSYECNQCGKAFRFRNDMVKHQRFCNVEKPFKCNQCGKAFSQKSHLTV
HQRIHTGEKPHECNQCGKAFIWRNRLIVHQRMHTGEKPFECNQCGKAFTHKSGLTVHQRI
HTGEKPFECNQCGKAFSQKSRLTVHQSIHTGEKPYECNQCGKAFTERNRLIVHQRMHTGE
KPFECNHCGKAFTHKSGLTVHQRIHTGEKAFECNQCGKAFPQKSRLTVHQSIHTGEKPYE
CNQCGKAFTERSMLTAHQRIHTGEKAYECNQCGKAFIWRNRLIVHQRMHTGEKPFECNQC
GKAFTHKTGLTVHQRIHTGEKPFECNQCGKAFSQKSRLTVHQSIHTGEKPFECNQCGMAF
SQKSRLTVHQSIHTGEKPYECNQCGKAFTERSMLTAHQRIHTGEKAYECNQCGKAFIWRN
KLTIHQRIHTGEKPFECNQCGKAFTQKSGLTVHQRIHTGEKPYECNQCGKAFSQKSSLTV
HQSIHTGEKPFE
Download sequence
Identical sequences F7BM42
ENSMODP00000004453 ENSMODP00000004453 13616.ENSMODP00000004453

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]