SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000004568 from Monodelphis domestica 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000004568
Domain Number 1 Region: 271-328
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 5.15e-26
Family Classic zinc finger, C2H2 0.0036
Further Details:      
 
Domain Number 2 Region: 495-552
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 9.37e-26
Family Classic zinc finger, C2H2 0.0048
Further Details:      
 
Domain Number 3 Region: 216-272
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.74e-25
Family Classic zinc finger, C2H2 0.005
Further Details:      
 
Domain Number 4 Region: 551-608
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.71e-25
Family Classic zinc finger, C2H2 0.0035
Further Details:      
 
Domain Number 5 Region: 131-188
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.78e-24
Family Classic zinc finger, C2H2 0.0062
Further Details:      
 
Domain Number 6 Region: 356-412
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 5.42e-24
Family Classic zinc finger, C2H2 0.0035
Further Details:      
 
Domain Number 7 Region: 607-664
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.01e-23
Family Classic zinc finger, C2H2 0.0046
Further Details:      
 
Domain Number 8 Region: 440-496
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 5.85e-23
Family Classic zinc finger, C2H2 0.0058
Further Details:      
 
Domain Number 9 Region: 663-720
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 5.88e-23
Family Classic zinc finger, C2H2 0.0056
Further Details:      
 
Domain Number 10 Region: 89-141
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.13e-21
Family Classic zinc finger, C2H2 0.0035
Further Details:      
 
Domain Number 11 Region: 709-761
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.11e-20
Family Classic zinc finger, C2H2 0.0022
Further Details:      
 
Domain Number 12 Region: 9-67
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 5.62e-20
Family KRAB domain (Kruppel-associated box) 0.001
Further Details:      
 
Domain Number 13 Region: 178-209
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000000804
Family Classic zinc finger, C2H2 0.0079
Further Details:      
 
Domain Number 14 Region: 318-349
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000117
Family Classic zinc finger, C2H2 0.012
Further Details:      
 
Domain Number 15 Region: 403-434
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000125
Family Classic zinc finger, C2H2 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000004568   Gene: ENSMODG00000023455   Transcript: ENSMODT00000004668
Sequence length 762
Comment pep:novel chromosome:BROADO5:4:410275623:410364144:-1 gene:ENSMODG00000023455 transcript:ENSMODT00000004668 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAPGTPRSPSQGSITFKDVAVDFTQEEWCLLDPSQKELFRKVMLENVQNLLFVGLPTTRA
YLISGSQGEESPWLLVKKDPKISCPGGIHTGEKPYECTQCGKAFTESSSLAKHQRIHTGE
KPYECIQCGKAFTQRGNLAAHQRIHTGEKPYKCTQCGKAFIHRVSLTVHQRIHTAQKPYE
CTQCGKAFIHRMNLAVHQRIHTAEKPYECTQCRKPFKQKRDLAVHQRIHTGEKPYECTQC
GKPFTQRGNLAAHQRIHTGEKPYECTQCGKAFIHRVSLTVHQRIHTGEKPYECKQCGKPF
TQRSNLVKHQRIHTGEKPYECTECGKAFTWRDQLATHQSIHSGQKPYECIQCGKPFTHSI
SLVAHQRIHTGEKPYECTQCGKPFTQRSNLVRHQRIHSGEKLHECTQCGKAFIRRDHLAT
HQTIHSGQKPYECTQCGKPFTHSISLAAHQRIHTGEKPYECTQCGKAFTRRNQLATHQRN
HNGKKPYECTQCGKAFTRSDNLAAHQRIHTGEKPYECTQCGKAFTRRGNLAAHQRIHSGE
KPYECTQCGKAFTERSHLVKHQRIHSGEKPYECTHCGKAFTESSSLARHQRIHTGEKPYE
CAQCGKAFTWRDQLATHQGIHSGQKPYECTQCGKAFTWRDQLTVHQRIHTGEKPYECTQC
GKAFTHSRDLAAHKRIHTGEKPYKCTQCGNAFRERSHLAAHKRIHTGEKPYDCTQCGKAF
TQRGNLVRHQRIHSGEKPYECTQCGKAFTERSHLVKHQRIHS
Download sequence
Identical sequences F7EVM8
ENSMODP00000004568 ENSMODP00000004568

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]