SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000004572 from Monodelphis domestica 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000004572
Domain Number 1 Region: 48-108
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 9.55e-23
Family KRAB domain (Kruppel-associated box) 0.0012
Further Details:      
 
Domain Number 2 Region: 1-34
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000000469
Family Classic zinc finger, C2H2 0.0054
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000004572   Gene: ENSMODG00000003732   Transcript: ENSMODT00000004672
Sequence length 179
Comment pep:novel chromosome:BROADO5:2:532156558:532185384:-1 gene:ENSMODG00000003732 transcript:ENSMODT00000004672 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
RIHTGEKPYECKQYGKTLRYSSKRLQHLKIHNGETGIHQMAYESYRLQAQEVVTLQDVAV
DFTWEEWRLLSPPQKELYREVMLENAQNLLSVGLPAPLEDVLSYLEQRKGPWMLEQKRLR
SCCPVHQEKQGSKEKKTMEDGLQLELQDSKIEDSKPKEKQRRQGRSIGTTHCKRPSLAV
Download sequence
Identical sequences F7EDB2
ENSMODP00000004572 ENSMODP00000004572 13616.ENSMODP00000004572

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]