SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000004594 from Monodelphis domestica 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000004594
Domain Number 1 Region: 217-274
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.44e-25
Family Classic zinc finger, C2H2 0.0055
Further Details:      
 
Domain Number 2 Region: 357-414
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.31e-24
Family Classic zinc finger, C2H2 0.0056
Further Details:      
 
Domain Number 3 Region: 161-218
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.41e-23
Family Classic zinc finger, C2H2 0.0052
Further Details:      
 
Domain Number 4 Region: 106-162
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.53e-23
Family Classic zinc finger, C2H2 0.0062
Further Details:      
 
Domain Number 5 Region: 273-330
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.35e-22
Family Classic zinc finger, C2H2 0.0064
Further Details:      
 
Domain Number 6 Region: 399-451
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.28e-20
Family Classic zinc finger, C2H2 0.0025
Further Details:      
 
Domain Number 7 Region: 2-49
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 3.66e-18
Family KRAB domain (Kruppel-associated box) 0.00079
Further Details:      
 
Domain Number 8 Region: 320-352
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000473
Family Classic zinc finger, C2H2 0.0095
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000004594   Gene: ENSMODG00000003755   Transcript: ENSMODT00000004694
Sequence length 457
Comment pep:novel chromosome:BROADO5:3:503944434:503950171:-1 gene:ENSMODG00000003755 transcript:ENSMODT00000004694 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
GSITFKDVALDFTQEEWCLLDHFQKELYLEVMLENVQNLLSVGYVLRDKEETGSKLHTEE
WSEQGVGQQHPASPGKKNIHSGEDIESGDQQSNKKGVGTEGKWECFSQKFKLAAHQRIHT
REKPHECKHCGRAFTQRSNLITHQKIHTGEKPFKCQQCGKAFTQRSNLISHQSIHTGEKP
YECQQCGKAFTQRSSLATHHKIHTGEKPYACLHCEKAFTKRSHLIRHQSIHTGEKPYECQ
QCGKAFTQRSSLATHQRIHIGEKPYECKHCGKAFIEKGSLAKHQSIHIGEKPYKCQQCGK
AFTQRSSLATHQRNHTGEKPYVCLYCEKAFTKRSHLITHQSIHTGENLYECQQCGKAFTQ
RSSLATHQRIHTGEKPYECKHCGKAFIEKGSLAKHQSIHTGEKPYECKHCGKAFTHRSNL
VSHQRIHTGEKPYGCQHCGKNFTQRGHLIAHQRIHTG
Download sequence
Identical sequences F7DV22
ENSMODP00000004594

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]