SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000004601 from Monodelphis domestica 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000004601
Domain Number 1 Region: 245-302
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 8.21e-25
Family Classic zinc finger, C2H2 0.0068
Further Details:      
 
Domain Number 2 Region: 301-358
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.79e-24
Family Classic zinc finger, C2H2 0.0041
Further Details:      
 
Domain Number 3 Region: 357-414
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 5.12e-23
Family Classic zinc finger, C2H2 0.0068
Further Details:      
 
Domain Number 4 Region: 190-246
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.47e-22
Family Classic zinc finger, C2H2 0.01
Further Details:      
 
Domain Number 5 Region: 2-58
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 1.24e-20
Family KRAB domain (Kruppel-associated box) 0.001
Further Details:      
 
Domain Number 6 Region: 399-451
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.47e-20
Family Classic zinc finger, C2H2 0.0057
Further Details:      
 
Domain Number 7 Region: 134-190
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 6.22e-20
Family Classic zinc finger, C2H2 0.0085
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000004601   Gene: ENSMODG00000009714   Transcript: ENSMODT00000004701
Sequence length 458
Comment pep:novel chromosome:BROADO5:3:521779334:521789303:-1 gene:ENSMODG00000009714 transcript:ENSMODT00000004701 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
GSITFKDVAVDFTQEEWCLLDHSQKALHLEVMLENVQNLLSVGLPVPIENFISCFQQGKA
PWLLEQKGPRSSCPGEKCIHEEVGFVLSSETAEMPMYEGNVGGMALGYSLDLIRHPKNKH
SEMVSVSDKGRRPFSQNSELPSCQRIHTGEKPFECKQCGKAVTWRASIAAHQSIHTGEKM
YECKQCGKPFIQIGHLARHQTIHSPEKPFKCKHCGKVFTQRGSLAAHQSVHTGEKPYACK
QCGKAFTWRASLAAHQSIHTGEKPYECKQCGKAFRQRATLDAHQRIHTGEKPYECKNCGK
AFTIRDSLTAHQRIHTGEKPYECKQCGKAFKERGHLAKHQRIHTGEKPYECKHCGKAFTQ
RGHLARHQTIHSGEKPFECKHCGKLFTQRGSLATHQSIHTGEKPYECKHCGKAFKQRGHL
ARHQTIHTGEKPYECKHCGKAFTRRDSLAAHQSTHFGE
Download sequence
Identical sequences F7AAS0
ENSMODP00000004601 ENSMODP00000004601 13616.ENSMODP00000004601

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]