SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000004614 from Monodelphis domestica 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000004614
Domain Number 1 Region: 278-332
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.11e-21
Family Classic zinc finger, C2H2 0.0047
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000004614   Gene: ENSMODG00000003749   Transcript: ENSMODT00000004714
Sequence length 335
Comment pep:novel chromosome:BROADO5:2:258383457:258430690:1 gene:ENSMODG00000003749 transcript:ENSMODT00000004714 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MVTQRSTVECLGHVGAQKTIRPSNAAEEVSRNERGDICFYLGPSQLSGASDDAQRRSSHG
DLRARILDKSARLDFSKTTTPIARHRLHMRVKASKALLREVLDHLQEVTSQKLWKKPKNH
SVAIYGQCHPRSFKKVNYSNILDLQRGLKDIKLNNQIVDEPNLDKAPPISYGLAISSKGS
PGNQAIADISLPIQVQLEQGAEPFVRCLQETERESAQKGLCSGNHLSPLPSVLTSTNHCR
CLPCANGGSSLTQDRPEKYKRICIGEKPNKYDECGKDFSDKYYLIEHQRIHTGKKICKCK
ECGKSFSHSSVLTQHKRIHTGEKPYGCNDCGKASE
Download sequence
Identical sequences F7AAK2
13616.ENSMODP00000004614 ENSMODP00000004614 ENSMODP00000004614

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]