SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000004832 from Monodelphis domestica 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000004832
Domain Number 1 Region: 100-286
Classification Level Classification E-value
Superfamily vWA-like 1.53e-40
Family Integrin A (or I) domain 0.0008
Further Details:      
 
Domain Number 2 Region: 1460-1659
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 3.17e-37
Family Pentraxin (pentaxin) 0.00063
Further Details:      
 
Domain Number 3 Region: 2866-2935
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 8.62e-20
Family Complement control module/SCR domain 0.0011
Further Details:      
 
Domain Number 4 Region: 2179-2248
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 2.5e-18
Family Complement control module/SCR domain 0.00085
Further Details:      
 
Domain Number 5 Region: 2808-2872
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 4.86e-18
Family Complement control module/SCR domain 0.0013
Further Details:      
 
Domain Number 6 Region: 1996-2064
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 5.98e-18
Family Complement control module/SCR domain 0.0011
Further Details:      
 
Domain Number 7 Region: 1880-1949
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 7.92e-18
Family Complement control module/SCR domain 0.001
Further Details:      
 
Domain Number 8 Region: 2750-2812
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 2.92e-17
Family Complement control module/SCR domain 0.0011
Further Details:      
 
Domain Number 9 Region: 3332-3399
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 4.59e-17
Family Complement control module/SCR domain 0.0011
Further Details:      
 
Domain Number 10 Region: 2925-2987
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 9.73e-17
Family Complement control module/SCR domain 0.00071
Further Details:      
 
Domain Number 11 Region: 2982-3046
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 1.53e-16
Family Complement control module/SCR domain 0.00091
Further Details:      
 
Domain Number 12 Region: 1822-1890
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 1.67e-16
Family Complement control module/SCR domain 0.00074
Further Details:      
 
Domain Number 13 Region: 3274-3343
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 2.36e-16
Family Complement control module/SCR domain 0.0018
Further Details:      
 
Domain Number 14 Region: 1717-1780
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 3.06e-16
Family Complement control module/SCR domain 0.00065
Further Details:      
 
Domain Number 15 Region: 2589-2656
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 4.45e-16
Family Complement control module/SCR domain 0.0015
Further Details:      
 
Domain Number 16 Region: 1938-2003
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 4.86e-16
Family Complement control module/SCR domain 0.00089
Further Details:      
 
Domain Number 17 Region: 2414-2484
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 6.12e-16
Family Complement control module/SCR domain 0.0016
Further Details:      
 
Domain Number 18 Region: 2473-2542
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000000000106
Family Complement control module/SCR domain 0.0013
Further Details:      
 
Domain Number 19 Region: 2298-2366
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000000000115
Family Complement control module/SCR domain 0.0013
Further Details:      
 
Domain Number 20 Region: 3098-3165
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000000000167
Family Complement control module/SCR domain 0.0015
Further Details:      
 
Domain Number 21 Region: 1253-1385
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0000000000000051
Family Growth factor receptor domain 0.011
Further Details:      
 
Domain Number 22 Region: 3451-3510
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000000000108
Family Complement control module/SCR domain 0.0012
Further Details:      
 
Domain Number 23 Region: 2532-2594
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000000000121
Family Complement control module/SCR domain 0.001
Further Details:      
 
Domain Number 24 Region: 2237-2302
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000000000139
Family Complement control module/SCR domain 0.0011
Further Details:      
 
Domain Number 25 Region: 3042-3108
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000000000181
Family Complement control module/SCR domain 0.0018
Further Details:      
 
Domain Number 26 Region: 464-531
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000000000431
Family Complement control module/SCR domain 0.0022
Further Details:      
 
Domain Number 27 Region: 3156-3221
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000000000486
Family Complement control module/SCR domain 0.0023
Further Details:      
 
Domain Number 28 Region: 2707-2757
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000000000278
Family Complement control module/SCR domain 0.0014
Further Details:      
 
Domain Number 29 Region: 3392-3460
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000000000361
Family Complement control module/SCR domain 0.0011
Further Details:      
 
Domain Number 30 Region: 2357-2425
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000000000987
Family Complement control module/SCR domain 0.0025
Further Details:      
 
Domain Number 31 Region: 403-474
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000000122
Family Complement control module/SCR domain 0.0019
Further Details:      
 
Domain Number 32 Region: 2053-2121
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000000136
Family Complement control module/SCR domain 0.0016
Further Details:      
 
Domain Number 33 Region: 1665-1734
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000000057
Family Complement control module/SCR domain 0.0018
Further Details:      
 
Domain Number 34 Region: 1380-1422
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000000641
Family EGF-type module 0.0046
Further Details:      
 
Domain Number 35 Region: 1418-1457
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000000471
Family EGF-type module 0.0047
Further Details:      
 
Domain Number 36 Region: 1022-1165
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.000000000107
Family Growth factor receptor domain 0.0085
Further Details:      
 
Domain Number 37 Region: 2118-2186
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000000195
Family Complement control module/SCR domain 0.0023
Further Details:      
 
Domain Number 38 Region: 3216-3281
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000000723
Family Complement control module/SCR domain 0.0026
Further Details:      
 
Domain Number 39 Region: 1776-1819
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000294
Family EGF-type module 0.032
Further Details:      
 
Domain Number 40 Region: 523-581
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000032
Family Complement control module/SCR domain 0.0048
Further Details:      
 
Domain Number 41 Region: 1230-1264
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000247
Family EGF-type module 0.0089
Further Details:      
 
Weak hits

Sequence:  ENSMODP00000004832
Domain Number - Region: 304-458
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.000204
Family Growth factor receptor domain 0.012
Further Details:      
 
Domain Number - Region: 3502-3538
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000295
Family EGF-type module 0.018
Further Details:      
 
Domain Number - Region: 754-814
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00043
Family Complement control module/SCR domain 0.0058
Further Details:      
 
Domain Number - Region: 3570-3601
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000939
Family EGF-type module 0.028
Further Details:      
 
Domain Number - Region: 3541-3570
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00206
Family EGF-type module 0.016
Further Details:      
 
Domain Number - Region: 70-86
Classification Level Classification E-value
Superfamily Formin homology 2 domain (FH2 domain) 0.0222
Family Formin homology 2 domain (FH2 domain) 0.12
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000004832   Gene: ENSMODG00000003939   Transcript: ENSMODT00000004935
Sequence length 3609
Comment pep:known_by_projection chromosome:BROADO5:6:102475686:102824072:-1 gene:ENSMODG00000003939 transcript:ENSMODT00000004935 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MWRLLPLYCWSLSLVSGWTAFQQIPTSGNFSFSFFPSSSSSSSSSSFPLATPQRQLQELE
PRRSLALALPPPPPPPPPLLPEPKENKVEKLGQSFKRNVRKLRERSHSLELVFLVDESSS
VGHANFLNELKFVKKLLSDFPVVPSATRVAIVTFSSKNNVVPRVDYISSSRAHQHKCSLL
NREIPNITYRGGGTYTKGAFQQAAQILRHSRENSTKVIFLITDGYSNGGDPRPIAASLRD
FGVEIFTFGIWQGNIRELNDMASTPKEEHCYLLHSFEEFEALARRALHEDLPSGNYIQED
ISHCSYLCEAGKDCCDIMASCKCGIHTGQFECICEKGYFGKGLQHECTACPSGTYKPEGS
PGGISTCIPCPDENHTSPPGSTSPEDCVCKEGYQAAGYACQVVHCPALRPPDNGYFIQNI
CNNHFNAACGIRCHTGFELVGSSIRLCQPNGLWSGSESSCRVRTCPQLRKPENGQISCTS
GETLYRTMCLVTCDEGYRLEGSPRLTCQGNSQWDGIEPRCVERHCPTFQKPKGVTIHPSS
CGRGPAKIGTVCQLSCPPGFILSGARGDVRCTSSGKWNAKIQAAICKDVEAPQIICPKDI
EAKTLEQQDSANITWIVPTAKDNSGEEVSIHVTPAFTPPYLFPIGEVAITYTAVDQSRNQ
ARCTFSVKVIDVEPPVIDRCRSPPPIQGPKNEYVATWDEPQFSDNSGSLLTITRSHSPGD
IFPQGRTTVQYTATDPSGNNRTCEIYVVIKGSPCEIPFTPVNGDFICTNDSVGINCTLSC
LEGYDFTEGSAEKYYCAFEDGIWRPPYSTEWPDCAVNRFANHGFKSFEMLYKTTCCDNND
LLKNFSKAFETTLGEMVPSFCNDADDIDCRLEDRTQKHCLEYNYDYENGFAIGPGGWGVA
NKVDYSYEDFMDVIQEQSQKPVMMGTGKTQTSRVKRHEKLSTSTSDHKIKLIFNITASVP
LPDQRNDTLELENQQRLLKTLETITNRLKRTLNKEPMYSFQLASEMVVADSNSLETEKAF
LFCRPGSMLRGRMCVNCPLGTYYSLEHTVCESCWIGSYQDEEGQLECKLCPTGSSTEYLH
SRSISECKAQCKQGTYSPNGLETCESCPLGTYQPAFGSKNCLSCPENTSTVKRGAVDKSA
CGVPCPIGEFSRSGIKPCYPCPRDYYQPNPGKSFCLSCPFYGTTTITGARSITDCSSFSS
TFSAAEESIMLSASPGHITKKYEVSSQVFHECFLNPCHNSGTCQQLGRGYVCICLPGFTG
LKCEIDVDECSSSPCLHNGVCKDGVDKFICQCPAGYTGQLCEGNINECRSNPCLNKGTCV
DGINGYHCSCVKGFKGTHCETEVNECQSDPCLNNAVCEDQIGGFLCKCLPGFRGTRCEKN
VDECLSSPCKNGGTCKDDINSFRCQCVTGYTGPRCEVNINECDSNPCRNQATCVDELNSY
SCKCRPGFSGSRCETEQSAGFNLDFEVSGIYGYVMLDGVLPTLHAITCTFWMKSSDINNY
GTPISYALENGSDNTFLLTDYNGWVLYVNGKERITDCPSVNDGNWHHISITWTSTDGSWK
VYIDGKLSDGGTGLSIGSAIPGGGALVLGQEQDKKGEGFNPAESFVGSISQLNIWDYVLA
PDQVKSLATSCPEGLSKGNVLAWPDFLSGVVGKVKIDSKSIFCSDCPSLDGFVPHLRTLT
VDLKAGSKVSLFCDAGFQIVGDAVQYCLNQGQWTQPLPHCERIGCGVPPPLENGFYSAED
FYAGSTVTYQCNNGYYLLGDSRMFCTDNGSWNGISPSCLDVDECAVGSDCDKHASCLNTN
GSYICTCIPPYTGDGKKCAEPIKCKDPGKTDNGQSSGNIYTVGGEVTFSCEEGYQLIGVT
KITCLESGKWSHQIPFCEAISCGGPVIPENCGIEGSTFTYGNKVTYRCNKGYKLIGEKES
FCLANGAWSHSPPMCELVKCPNPQNIINGKYLPNGLTYLSTTTYSCDSGYSLKGPSVIEC
TATGNWNTAPPVCELIFCGDPPAIKDAVIKGSNFTFGNTVTYTCKEGYTLVGTETIECLA
SGLWSESDQQCLAVSCDEPPSVEHASPETSHRLYGDVAYYYCADGYSLAGNSQLHCDAQG
QWVPLEGQAVPHCIADFCEKPPAVLYSILESVSKARFAAGSIVSFKCMEGFVLNTSSKIE
CMRGGHWNPSPMSIQCIPVRCGEPPSIKNGYASGSNYSFGAVVAYSCNRGFYIKGEKKST
CEATGQWGSRIPTCHPVSCNEPPKIENGFVEHTTGKVFESEVRYQCNPGYKMVGSPAFVC
QANRQWHSESPPVCIPLSCGKPPSLQNGYIKGENFEVGSKVQFFCNEGYDLVGDASWTCQ
KSGKWNRKPNQKCVPAKCPDPPLLENQLVIKELVHEVGLVQFSCKEGYVLQGPSILKCLV
SQRWNGSFPFCKMVLCLPPPLISFGVPDSSPALHFGTVIKYSCVDGFFMRGDSTTSCQAD
GSWSSPLPECIPVECPQPEEIPNGIIDVQGLAYLSTALYTCKPGFELMGNMTILCGEDGH
WLGGKPTCKPIECPKPSEILNGKLFYTNLHYGQTISYSCDRGFSLEGPKTLTCLETGDWD
VAVPSCSAIYCEPPQPIENGFVEGADYSYGAMIIYSCFPGFQLTGHAMQTCDETGWSSFI
PTCLPIDCGLPPHIDFGDYVKVKGQEGYFDQEDDVMEVPYLTPEPPHSLSPMESTWKSRK
GPTVSQIPNFFYGTLVLYSCNPGHELLGNPMLICQEDGTWNGSAPACISIECDLPSQPEN
GFLHFTENTMGSVVHYSCNPGHVLVGSSRRLCLSNRQWSDNAPHCEVISCNKPNPLMNGS
IQGGNYTYLSVLHYSCNPGYELNGSSRRTCQEDSQWDGNEPICVPVACGPPPVSENSQVS
GNEYTFQKEIVYTCDEGFLLQGSSSRVCLANGSWSGVTPVCVAIKCPVPPQIVNGEVSEL
EHSFGKEIDFHCHEGYVLHGSTKLTCQMDGTWDGEAPLCKPVHCGPPEDLSHGFLNGSSF
SYGDYIQYVCFPGYELLGTPLRQCLSSGSWSGSPPSCLPCECPMPMIQNGLIVGEDFSCG
KVAQFQCLEGFKLLGPSEITCEAAGQWSAGFPLCGRNSCGPPPTILNAFINGGSSLEENA
ITYSCMTGYVMQDRSDLICTEKGTWSEPYPSCEPLSCGPPPAVANAVATGKAHTYGSKVH
LRCLEGYVMESDTDTMTCLKDGNWSPDSISCIPKKCSLPTDMNKILVLGDEFSVNKQVSV
SCVKGYTLEGENISTCQLDGSWDPPFSDDSCTPVSCGKPETPEHGLVLGIEYSFKSTIIY
QCEAGYELEGDSERFCQENKQWSGAVALCKKIKCEAPIQFENGRIEYENKTVGPRVIYSC
NKGYSLEGESITECTENGTWSHPIPFCKPNPCPVPFVIPENALLSEKEFYVGQNVSIKCR
EGYVLQGQAVITCNPDETWTPTNAKCEKISCGPPVHVENAIARGIHYQYGDLITYSCYSG
YMLEGSLRSVCLGNGTWTSPPTCRAVCRFPCQNGGVCQRPNACTCLEGWMGRLCEEPICI
LPCLNGGRCVAPYQCDCSTGWTGSRCHTAVCQSPCLNGGKCIRPNRCHCLSTWTGHDCSR
KRKTGFHPF
Download sequence
Identical sequences F7G9T3
ENSMODP00000004832 XP_001374633.1.35504 ENSMODP00000004832

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]