SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000004997 from Monodelphis domestica 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000004997
Domain Number 1 Region: 545-934
Classification Level Classification E-value
Superfamily Ribonuclease H-like 8.34e-32
Family Hermes transposase-like 0.0016
Further Details:      
 
Domain Number 2 Region: 440-517
Classification Level Classification E-value
Superfamily Hermes dimerisation domain 4.32e-20
Family Hermes dimerisation domain 0.0062
Further Details:      
 
Domain Number 3 Region: 221-243,370-397
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000943
Family Classic zinc finger, C2H2 0.027
Further Details:      
 
Domain Number 4 Region: 112-175
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000205
Family Classic zinc finger, C2H2 0.033
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000004997   Gene: ENSMODG00000004063   Transcript: ENSMODT00000005104
Sequence length 936
Comment pep:known_by_projection chromosome:BROADO5:1:451740212:451892609:-1 gene:ENSMODG00000004063 transcript:ENSMODT00000005104 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDPKRSSLRAEGASATGRRNTPGREKLKRNQKSPKAEDPSPVPVETSQCSEEERMTEVKV
KTELPDDYIQEVIWQDDAKESKKNVKEGSGDVPAEICVVIGGVRNQQTLGSYECGICGKK
YKYYNCFQTHVRAHRDTEAASGEGASQGNNFRYTCDICGKKYKYYSCFQEHRDLHAVDVF
SVEGAPENRADPFDQSVVATDEVKEEPPEPFQKIGPKTGNYTCEFCGKQYKYYTPYQEHV
ALHAPISTSAGWEPSEEPDASSECSHPEFSRSPLFMAVKTPTSQSGKKTPASIVRCSTLL
QRTSSGAPPASQTQMFRTPNSGSPGSKATTESAFSRRVESKAQNNFEETNSSSQNSSEAA
SPLISNPFPLLQKPYTCGACGIQFQFYNNLLEHMQSHAADNENNIAFNQPRSPPAVVEEK
WKPQPQRNSTNNTSVSGSAPNSTIPEKERQNIAERLLRVMCADLGTLSVVSGKEFLKLAQ
TLVDSGARYGAFSVTEILGNFNTLALKHLPRMYNQVKVKVTCALGSNACLGIGVTCHSQS
IGPDSCYILTAYQAEGNHIKSYVLGIKGVDIRDSGDFIHHWVQNVLSEFVMSEIRTVYVT
DCRVNSSAFSKAGMCLRCSACALNSVVQSVLNKRTLQARNMHEVIELLNVCEDLAGSTGL
SKETFGSLEETSPPPCWNSVTDSLLLVHERYEQICEFYSRAKKMNLIQNLNKHLLSNLAA
ILAPVKQAVIELSHESRPTLQLVLPTYVKLEKLFTSKANDAGVVSKLCHLFLEALKENFK
VHSAHKVAMILDPQQKLRPVPPYQHEEIIGKVCELINEVKESWSEEVDFEPSTKKPRASG
DATPAQEDDRFGKNEVYDYLQEPLFQSTPDLFQYWSCVTQKHTKLAKLAFWLLAVPAVGA
RSECVNMCEQALLIKRRRLLSPEDMNKLMFLKSNML
Download sequence
Identical sequences F7BIT4
ENSMODP00000004997 XP_007475039.1.35504 ENSMODP00000004997

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]