SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000005095 from Monodelphis domestica 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000005095
Domain Number 1 Region: 1-114,177-410
Classification Level Classification E-value
Superfamily ARM repeat 6.2e-99
Family Diap1 N-terninal region-like 0.00087
Further Details:      
 
Domain Number 2 Region: 518-525,584-956
Classification Level Classification E-value
Superfamily Formin homology 2 domain (FH2 domain) 5.89e-89
Family Formin homology 2 domain (FH2 domain) 0.0000256
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000005095   Gene: ENSMODG00000004138   Transcript: ENSMODT00000005205
Sequence length 1049
Comment pep:known_by_projection chromosome:BROADO5:4:155116864:155311228:1 gene:ENSMODG00000004138 transcript:ENSMODT00000005205 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MNLPPDKARLLRQYDNEKKWELICDQERFQVKNPPHTYIQKLKGYLDPAVTRKKFRRRVQ
ESTQVLRELEISLRTNHIGWVREFLNEENKGLDVLVEYLSFAQYAVTFDFESLENNVENS
VDKSKPWSRSIEDLHRGSNLPSPVGNSISRSGRHSTLRYNTLPSRRTLKNSRLVSKKDDV
HVCIMCLRAIMNYQYGFNMVMSHPHAVNEIALSLNNKNPRTKALVLELLAAVCLVRGGHE
IILSAFDNFKEVCGEKQRFEKLMEHFRNEDNNIDFMVASMQFINIVVHSVEDMNFRVHLQ
YEFTKLGLDEYLDKLKHTESDKLQVQIQAYLDNVFDVGALLEDAETKNAALERVEELEEN
ISHLSEKLQDTENEAMAKIVELEKQLMQRNKELDVVREIYKDANTQVHTLRKMVKEKEEA
IQRQSTLEKKIHELEKQGTIKIQKKGDGDISILPVVASGTLPAGTEATVNPNAFVGQVPG
TPSSVPSPPPPPPLPPSTAASETVQNGPVTSPVPPPPPPPPPPPPPPPLPGPATDTPPAP
LPPPPPPSAPPLPGTASPTVVFNSGLAAVKIKKPIKTKFRMPVFNWVALKPNQINGTVFN
EIDDERILEDLNVDEFEEIFKTKAQGPAIDLTSSKQKITQKGSNKVTLLEANRAKNLAIT
LRKAGKTADEICKAIHIFDLKTLPVDFVECLMRFLPTENEVKVLRLYERERKPLENLSDE
DRFMMQFSKIERLMQKMTIMAFIGNFSESIQMLTPQLHAIIAASVSIKSSQKLKKILEII
LALGNYMNSSKRGAVYGFKLQSLDLLLDTKSTDRKQTLLHYISNVVREKYHQVSLFYNEL
HYVEKAAAVSLENVLLDVKELQRGMDLTKREYTMHDHNTMLKDFIHNNEGKLKKLQDDAK
IAQDAFDDAVKYFGENPKTTPPSVFFPVFVRFVKAYKQAEEENELRKKQEQALMEKLLEQ
EALMEQQDPKSPSHKTKRQQQELIAELRRRQVKDNRHVYEGKDGAIEDIITALKKNNITK
FPNVHSRVRISSSTPVVEDTQSWQALLFT
Download sequence
Identical sequences F6UDT7
ENSMODP00000005095 ENSMODP00000005095

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]