SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000005099 from Monodelphis domestica 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000005099
Domain Number 1 Region: 182-239
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.81e-26
Family Classic zinc finger, C2H2 0.0043
Further Details:      
 
Domain Number 2 Region: 518-575
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.33e-26
Family Classic zinc finger, C2H2 0.0042
Further Details:      
 
Domain Number 3 Region: 351-407
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 7.44e-26
Family Classic zinc finger, C2H2 0.0037
Further Details:      
 
Domain Number 4 Region: 462-519
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.57e-25
Family Classic zinc finger, C2H2 0.0051
Further Details:      
 
Domain Number 5 Region: 238-295
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 4.66e-24
Family Classic zinc finger, C2H2 0.0038
Further Details:      
 
Domain Number 6 Region: 294-351
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 5.73e-24
Family Classic zinc finger, C2H2 0.0064
Further Details:      
 
Domain Number 7 Region: 9-69
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 1.7e-22
Family KRAB domain (Kruppel-associated box) 0.0012
Further Details:      
 
Domain Number 8 Region: 406-463
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 4.8e-22
Family Classic zinc finger, C2H2 0.0086
Further Details:      
 
Domain Number 9 Region: 560-612
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.35e-19
Family Classic zinc finger, C2H2 0.0051
Further Details:      
 
Domain Number 10 Region: 129-183
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000000012
Family Classic zinc finger, C2H2 0.026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000005099   Gene: ENSMODG00000023634   Transcript: ENSMODT00000005209
Sequence length 625
Comment pep:novel chromosome:BROADO5:3:502957325:502983758:-1 gene:ENSMODG00000023634 transcript:ENSMODT00000005209 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MALEKDRLPTQEVVTFKDVAVDFTREEWRLLSPPQKELYKEVMLENAWNLLSVGLPAPPE
DVISSLEQREAPWMLEQEGLRSCCPGDTMSVMKTNPTEMSLPVKELDLQRFISHGPNNFA
FREFCVLPQNSSRIEHQRMHTKEKSSVNYACGKTFMHRDILPRYQNISIGEKSYECQQCG
RSFRQSSSLAVHQRIHTGEKPYECKHCGKTFSWNSHLALHQRIHTGEKPYECQQCGKAFS
CNSHLAVHQRIHTGEKPYECKECGKKFKQSSALLVHQRIHTGEKSHECKQCGKTFSQKSH
RALHQRTHTGEKHYECNQCGKTFSMTSALAVHQRIHTGEKPYPCNQCGKKFSQLSHLTIH
QRTHTGEKPYECKECGKAFICSSILAVHQRIHTGEKPYECNHCGKTFSCISNLAVHQRIH
TEKKPYECKHCGKTFSQRYHLTLHQRAYTGEKPFACKQCGKTFSQSSTLAEHQRIHTGEK
PYECKHCGKAFSCSSTLTVHKRIHTGEKPYECKHCGKTFSWSSNLAKHQRIHTGEKPYEC
KHCGKAFSQNSHLALHQRIHTGEKPYECKHCGKTFSCSSTLAVHQRTHTGEKPYECKQCE
KTFSCSSHLSVHQRIHIGEKLNKCN
Download sequence
Identical sequences F6UDM5
ENSMODP00000005099 XP_016288370.1.35504 ENSMODP00000005099

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]