SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000005106 from Monodelphis domestica 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000005106
Domain Number 1 Region: 45-137
Classification Level Classification E-value
Superfamily Retrovirus capsid dimerization domain-like 6.87e-38
Family SCAN domain 0.0000575
Further Details:      
 
Domain Number 2 Region: 319-376
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 7.07e-26
Family Classic zinc finger, C2H2 0.0043
Further Details:      
 
Domain Number 3 Region: 361-413
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.54e-19
Family Classic zinc finger, C2H2 0.0051
Further Details:      
 
Domain Number 4 Region: 281-333
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 8.99e-17
Family Classic zinc finger, C2H2 0.0091
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000005106   Gene: ENSMODG00000028855   Transcript: ENSMODT00000005216
Sequence length 451
Comment pep:known_by_projection chromosome:BROADO5:2:257812615:257822783:-1 gene:ENSMODG00000028855 transcript:ENSMODT00000005216 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MMTAESKETADLSPQALQDQDGPIIIKVEDDSTWEQESSQQSNSHPSQEIWRQRFRQLSY
QETPGPREALSRLRTLCCEWLRPEMHTKEEILELLVLEQFLSILPEELQIWLQERHPESG
EEVVILLEDLERELDEPGQQVSDHSQEQALLWEGVTPPFPAPVTLRKSPNIQVHDMETQL
KCEPVEPHPLQKFDCQSKHQNEESTPKHEISKVEPPAVVSGRFIGDVAEKTKYREAHDHE
STLQRQWEKPIGEITRKYSFPETESREVSNLIHSKPFPEEKCYQCVVCGKTCSNSSNFRK
HQRTHTGETPYKCKECEKTFRSKASLIQHQRIHTGEKPYQCNQCGKSFSQQAGLISHQRL
HTGERPYKCNECGKTFSHSSNLIKHQRIHSKEKPYHCSKCEKAFCTKSNLSQHQRVHMPK
GEKHGRCGENSEFAYSLLNVKEGPLGKNSTV
Download sequence
Identical sequences F6RA87
ENSMODP00000005106 ENSMODP00000005106 XP_016286358.1.35504 XP_016286359.1.35504

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]