SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000005127 from Monodelphis domestica 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000005127
Domain Number 1 Region: 1007-1220
Classification Level Classification E-value
Superfamily SET domain 5.76e-73
Family Histone lysine methyltransferases 0.00096
Further Details:      
 
Domain Number 2 Region: 220-370
Classification Level Classification E-value
Superfamily Tudor/PWWP/MBT 1.81e-26
Family PWWP domain 0.0053
Further Details:      
 
Domain Number 3 Region: 902-1003
Classification Level Classification E-value
Superfamily Tudor/PWWP/MBT 2.89e-26
Family PWWP domain 0.0000198
Further Details:      
 
Domain Number 4 Region: 846-914
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 0.0000000000000332
Family PHD domain 0.004
Further Details:      
 
Domain Number 5 Region: 441-508
Classification Level Classification E-value
Superfamily HMG-box 0.0000000000103
Family HMG-box 0.0022
Further Details:      
 
Domain Number 6 Region: 1244-1311
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 0.0000000000266
Family PHD domain 0.0058
Further Details:      
 
Domain Number 7 Region: 687-738
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 0.000000000122
Family PHD domain 0.0097
Further Details:      
 
Weak hits

Sequence:  ENSMODP00000005127
Domain Number - Region: 742-795
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 0.0244
Family PHD domain 0.044
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000005127   Gene: ENSMODG00000004162   Transcript: ENSMODT00000005237
Sequence length 1392
Comment pep:known_by_projection chromosome:BROADO5:5:232962367:233039434:-1 gene:ENSMODG00000004162 transcript:ENSMODT00000005237 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MNFSIRRNSPSLTQKIVSQLKMKQVPEILGNTNGKTQNCEVNRECSVFLSKAQISTTLPE
GVMQKFNGHEALPFIPAEKLKDLTSRVFNGESGAQDAKLRFESQEIKGIGTPPHTTPIKN
GSPEIKLKITKTYMNGKPLFESSICGDNGPDVSQSEENEQKLENKSRRNRKRSIKYDSLL
EQGLVEAALVSKASSPSEKKILAKRESYPNINKEKDHLLKYNVGDLVWSKVSGYPWWPCM
VSADPLLHSYTKLKGQKKSARQYHVQFFGDAPERAWIFEKSLVSFEGEEQFEKLCQESAK
QAPTKAEKIKLLKPISGKLRTQWEMGIIQAKEAVSMTVEERKAKFTFVYVRDRLHLNPQV
AKEAGIAVDPLEEIEESSDMSEETAQNLKHKELGVPIKRRRRSKLLSCTDNLESDSGPKN
ITPQRAAEQADSKRGLGSPVGRKKAAASTPRSRKGDSGSQFLVFCQKHRDEVVAEHPDAS
SEEIEELLESQWNMLNEKQKARYNTKFAIVTSPKSEEDSGSSLKNIGDTKRKVFQDSPKR
RSRSRSNLHGKKRNNTKRTQHPTEDFEVQEPPRKRLRMDKQNNRKRETSNDKATKTNSSK
VTETSSSLKNQSATKNLSDACKPLKKRNRASATESSTLAFSKSSSPSTSLTENEISDGQG
DEPSESPYESADETQTEISISSKKSERGTTAKKEYVCQLCEKSGNLLLCEGPCYGAFHLS
CLGLSRRPEGKFICSECTSGIHSCFVCKEKKTEVKRCVVSQCGKFYHEACVKKYHLTVFE
SRGFRCPLHSCVSCHVTNPSNPRSSKGKMMRCVRCPVAYHGGDGCLAAGCSVIASNNIVC
TNHFTARKGKSHHAHVNVSWCFVCSKGGSLLCCESCPAAFHPDCLNIEMPDGSWYCNDCR
AGKKLHFQDIIWVKLGNYRWWPAEVCHPKNVPPNIQKMKHEIGEFPVFFFGSKDYYWTHQ
ARVFPYMEGDRGSRYQGIKGIGKVFKNALHEAEARFREIKLQREARETQENERKPPPYKH
IKVNKPCGKVQIYTADVSEIPKCNCKPTDENPCGFDSECLNRMLMYECHPQVCPAGEQCQ
NQCFTKRQYPETKIIKTDGKGWGLVAKRDIKKGEFVNEYVGELIDEEECMARIKYAHEND
ITHFYMLTIDKDRIIDAGPKGNYSRFMNHSCQPNCETLKWTVNGDTRVGLFAVCDIPAGT
ELTFNYNLDCLGNEKTVCRCGASNCSGFLGDRPKNSAALSSEEKGKKTKKKTRRRRTKGE
GKKESEDDCFRCGDGGQLVLCDRKCCTKAYHLSCLDLVKRPFGKWECPWHHCDVCGKPSV
SFCHFCPNSFCKEHQDGTVFSTTQDGRLCCSEHDFGVESIRNPKTEKPFPEPTKLKPKRK
KRRCWRRKTECK
Download sequence
Identical sequences F6R9V6
ENSMODP00000005127 XP_016278849.1.35504 ENSMODP00000005127

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]