SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000005128 from Monodelphis domestica 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000005128
Domain Number 1 Region: 212-263
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.67e-17
Family Classic zinc finger, C2H2 0.0068
Further Details:      
 
Domain Number 2 Region: 185-224
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000000846
Family Classic zinc finger, C2H2 0.04
Further Details:      
 
Domain Number 3 Region: 254-288
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000671
Family Classic zinc finger, C2H2 0.018
Further Details:      
 
Weak hits

Sequence:  ENSMODP00000005128
Domain Number - Region: 156-180
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0963
Family Classic zinc finger, C2H2 0.033
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000005128   Gene: ENSMODG00000004165   Transcript: ENSMODT00000005238
Sequence length 296
Comment pep:known_by_projection chromosome:BROADO5:1:695666066:695675186:-1 gene:ENSMODG00000004165 transcript:ENSMODT00000005238 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
ARSFLVKKHWSNRIPNYGQLESQKEINGSCYTCEGLVFPLLLQDKAAPSGSSDASSLWDR
NSVIACISLPLPLNGEARETPSPSPLEISVVDSLDGRVPSSPLKDSLSHLTLSPLLDIPK
RWPLNPGPEAVKAPGKLLGGGGPRGGSPPLGSVGCFECFDCHKTYHTFSGLSKHRQLRCD
LQARRFFSCKYCDKEYSSLGALKMHIRTHTLPCICKICGKAFSRPWLLQGHIRTHTGEKP
YACSHCSRAFADRSNLRAHLQTHSDIKKYQCKGCTKTFSRMSLLTRHKDAGSCPAS
Download sequence
Identical sequences F6R9U8
13616.ENSMODP00000005128 ENSMODP00000005128 ENSMODP00000005128

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]