SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000005154 from Monodelphis domestica 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000005154
Domain Number 1 Region: 423-486
Classification Level Classification E-value
Superfamily FF domain 4.32e-18
Family FF domain 0.0000204
Further Details:      
 
Domain Number 2 Region: 782-844
Classification Level Classification E-value
Superfamily FF domain 0.00000000000222
Family FF domain 0.0000205
Further Details:      
 
Domain Number 3 Region: 183-217
Classification Level Classification E-value
Superfamily WW domain 0.00000000000292
Family WW domain 0.00033
Further Details:      
 
Domain Number 4 Region: 641-713
Classification Level Classification E-value
Superfamily FF domain 0.00000000000345
Family FF domain 0.0043
Further Details:      
 
Domain Number 5 Region: 558-633
Classification Level Classification E-value
Superfamily FF domain 0.00000000000772
Family FF domain 0.0042
Further Details:      
 
Domain Number 6 Region: 214-252
Classification Level Classification E-value
Superfamily WW domain 0.00000000136
Family WW domain 0.0015
Further Details:      
 
Domain Number 7 Region: 491-560
Classification Level Classification E-value
Superfamily FF domain 0.000000034
Family FF domain 0.004
Further Details:      
 
Weak hits

Sequence:  ENSMODP00000005154
Domain Number - Region: 98-152
Classification Level Classification E-value
Superfamily beta-sandwich domain of Sec23/24 0.0133
Family beta-sandwich domain of Sec23/24 0.04
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000005154   Gene: ENSMODG00000004179   Transcript: ENSMODT00000005264
Sequence length 996
Comment pep:known_by_projection chromosome:BROADO5:4:155317172:155375520:-1 gene:ENSMODG00000004179 transcript:ENSMODT00000005264 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MQATPSEAEAGGESPQSCVQAARSDWTAGKPVSLLAPLIPPRSSGQPLPFGPSGRQPLRS
LLVGMCSGSGRRRSSLSPTMRPGTGAERGGLMMGHPGMHYPPMGMHPMGQRGNMQPVPHG
MMQQMMPPMGGPPMGQMPGMMSSVMPGMMMTHMSQASIQPALPPGVNNMDVAVGATSGTQ
KSMWTEHKSPDGRTYYYNTETKQSTWEKPDDLKTPAEQLLSKCPWKEYKSDSGKPYYYNS
QTKESRWAKPKELEDLEGYQNTIVAGSLITKSNLHAMIKAEESSKEESTTTSAAPVPTTE
ITTTMSTMAAAEAAAAVVAAAAAAAAAAAAANASANATISTPSSIVASTTPIVTEPEVTS
IVATVIDNDNTVTISTEEQAQLVTPIVHEQSVEVSSNVPEETSKQEASVDFTPKKEEEDS
QPAKKTYTWNTKEEAKQAFKELLKEKRVPSNASWEQAMKMIINDPRYSALAKLSEKKQAF
NAYKVQTEKEEKEEARSKYKEAKESFQRFLENHEKMTSTTRYKKAEQMFGEMEVWNAISE
RDRLEIYEDVLFFLSKKEKEQAKQLRKRNWEALKNILDNMANVTYSTTWSEAQQYLMDNP
TFAEDEELQNMDKEDALICFEEHIRALEKEEEEEKQKSLLRERRRQRKNRESFQIFLDEL
HEHGQLHSMSSWMELYPTISSDIRFTNMLGQPGSTALDLFKFYVEDLKARYHDEKKIIKD
ILKDKGFLVEVNTTFEDFVAVISSTKRSTTLDAGNIKLAFNSLLEKAEAREREREKEEAR
KMKRKESAFKSMLKQAAPPIELDAVWEDIRERFVKEPAFEDITLESERKRIFKDFMHVLE
HECQHHHSKNKKHSKKSKKHHRKRSRSRSGSDSDDDDSHSKKKRQRSESRSASERSSSAE
SERSYKKSKKHKKKSKKRRHKSDSPESDADREKDKKEKERENEKDRTRQRSESKHKSPKK
KTGKDSGNWDTSGSELSEGELEKRRRTLLEQLDDDQ
Download sequence
Identical sequences F6QNU6
ENSMODP00000005154 XP_007494236.1.35504 ENSMODP00000005154

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]