SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000005211 from Monodelphis domestica 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000005211
Domain Number 1 Region: 61-175
Classification Level Classification E-value
Superfamily POZ domain 9.42e-31
Family BTB/POZ domain 0.00094
Further Details:      
 
Domain Number 2 Region: 448-500
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000000002
Family Classic zinc finger, C2H2 0.0064
Further Details:      
 
Domain Number 3 Region: 427-456
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000207
Family Classic zinc finger, C2H2 0.018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000005211   Gene: ENSMODG00000004228   Transcript: ENSMODT00000005324
Sequence length 556
Comment pep:known_by_projection chromosome:BROADO5:2:66321631:66334103:1 gene:ENSMODG00000004228 transcript:ENSMODT00000005324 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGGGVRVSDFLPARRPLGGRGRGVSLPGRCSGPFRPISTPGAGLKACTISEHTMEKGGNI
QLEIPDFSNSVLSHLNQLRMQGRLCDIVVNVQGQAFRAHKVVLAASSPYFRDHMSLNEMS
TVSISVIKNPTVFEQLLSFCYTGRICLQLADIISYLTAASFLQMQHIIDKCTQILEGIHF
KINVAEVEAELGQTRTKHQERPPESHRVTPNLNRPLSPRHNTPKGSRRGQVSTVLDIREL
SPPEESTSPQIIEQSSDAESREPILRINRAGQWYVETGVADRGGRSDDEVRVLGGVRIKT
ENLEEWLGTENQPSGEDGSSAEEVAAMVIDTTGHGSGGQENYALASSAPKATRPTSSEMD
RFSPSGSVVTLTERHRARSESPGRMDEPKQPNSQVEESAMIGVSGYVEYLREQEVSERWF
RYNPRLTCIYCAKSFNQKGSLDRHMRLHMGITPFVCRMCGKKYTRKDQLEYHIRKHTGNK
PFHCHVCGKSFPFQAILNQHFRKNHPGCMPLEGPHSISPETTVTSRGQAEEESPPQEETV
APGETAQGSVSTTGPD
Download sequence
Identical sequences F6UBR2
XP_007480882.1.35504 ENSMODP00000005211 ENSMODP00000005211

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]