SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000005230 from Monodelphis domestica 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000005230
Domain Number 1 Region: 2057-2124
Classification Level Classification E-value
Superfamily Homeodomain-like 3.68e-17
Family Homeodomain 0.0041
Further Details:      
 
Domain Number 2 Region: 1846-1915
Classification Level Classification E-value
Superfamily Homeodomain-like 4.71e-17
Family Homeodomain 0.0053
Further Details:      
 
Domain Number 3 Region: 1589-1656
Classification Level Classification E-value
Superfamily Homeodomain-like 8.55e-16
Family Homeodomain 0.0053
Further Details:      
 
Domain Number 4 Region: 2144-2188
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000000104
Family HkH motif-containing C2H2 finger 0.015
Further Details:      
 
Domain Number 5 Region: 1190-1214,1244-1269
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000478
Family Classic zinc finger, C2H2 0.031
Further Details:      
 
Domain Number 6 Region: 497-539
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000045
Family Classic zinc finger, C2H2 0.009
Further Details:      
 
Domain Number 7 Region: 2475-2522
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000941
Family Classic zinc finger, C2H2 0.041
Further Details:      
 
Domain Number 8 Region: 1674-1695,1765-1792
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000976
Family Classic zinc finger, C2H2 0.039
Further Details:      
 
Weak hits

Sequence:  ENSMODP00000005230
Domain Number - Region: 796-853
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000323
Family Classic zinc finger, C2H2 0.067
Further Details:      
 
Domain Number - Region: 559-601
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000676
Family Classic zinc finger, C2H2 0.057
Further Details:      
 
Domain Number - Region: 1008-1036
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00436
Family Classic zinc finger, C2H2 0.038
Further Details:      
 
Domain Number - Region: 1472-1503
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00768
Family Classic zinc finger, C2H2 0.042
Further Details:      
 
Domain Number - Region: 452-489
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0169
Family Classic zinc finger, C2H2 0.033
Further Details:      
 
Domain Number - Region: 866-904
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0506
Family HkH motif-containing C2H2 finger 0.093
Further Details:      
 
Domain Number - Region: 742-789
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0894
Family Classic zinc finger, C2H2 0.034
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000005230   Gene: ENSMODG00000004244   Transcript: ENSMODT00000005343
Sequence length 2564
Comment pep:known_by_projection chromosome:BROADO5:1:172948416:172961945:-1 gene:ENSMODG00000004244 transcript:ENSMODT00000005343 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MATLNSLSTASNTSTPGHNAPSPPQDPSSGTSFESATKDPPTAATTDSMRPSEPGGHQLE
PGCGLVPPKETREHPLEPGCGLIPPKELGAEVEEEDKIQEEEAGPPPQDLSAHLLFTEDG
AAYLLAELPLSGNSELLLPKGFPWGESGTEEESGLPLRVCPSSTHLNVLHIQHGFDRIQG
FSSSDQILPRNTSAPPLAACKGGDGAFRSYRPAPLPPRDPKDGPIGSGDIDHRELFWLCL
LCRLGFGGPEAFVAHAQSHGVKLAAVQHQSLPSCPAVIQEGKEGSAVLVSFLEPKISPGP
LPMAPLSNGAVGGMVNVAQDTDSTPEVGNQGPPLPLEEDMAPSPPSPPATPTAWDPNPTQ
AKELPVAAGEAGPDWFPEGQEEDGGLCPPLNQSSPSPKDGGALPAQADSPEDPNDPPRPY
RLADDYAPAPPAFQGLSLSSHMSLLHSRNSCKTLKCPKCNWHYKYQQTLDVHMREKHPEN
NSHCSYCSAGGAHPRLARGESYNCGYKPYRCEVCNYSTTTKGNLSIHMQSDKHLANLQGF
QAGPGGQGSPTEAALPAPPGEKEPKAKSSWQCKVCSYETNISRNLRIHMTSEKHMQNVLL
LHQGLPLGLPPGLVGPGPPPPPGAASANPPELFPYYGPQGLGQPSAPLPGPGLRPDKPLE
AQLLLNGFHHLGPPTRKYPTPAPGSLSPEPRLPPNQLLGPTMDGPPTSPPPDDDPSLKVF
RCLVCQAFSTDSLELLLYHCTLGRSLPEAEWKEVAGDTHRCKLCCYGTQLKANFQLHLKT
DKHAQKYQLVAHLREGGGAAPAPGPALGEGAPYGPVSPLHLRCNLCDFESNSKEKMQLHA
RGGTHEENSQVYKFLLEMEGTEAGVELGLYRCLLCAWETPSRLALLQHLRAPAHRDAQAQ
RRLQLLQSGRVAEEGLSALQSILCFSHSQPRTLGKVPISTHVEPLTAEKNTQNKAPPLAS
EEAENRTGPSGDNTNQTVVYCCPYCSFISPANEQVQAHTISQHAVQPKYRCPLCQEQLLG
RSGLHYHLSHLHNVVPECVEKLLLVATTVEMTFLTKVLPGTSLSPIGDSPEPPAPGTEPG
SSGDSAVEEGPNPIPEVNPDPLPEPLPPPAEVPDKPLTSPEKPPSPAPSPLPQPDPQTEE
APPSMASVEEDEGPPGELRPAEPSPADARHPLSYRKTTNFALDKFLDPARPYKCTVCKES
FTQKNILLVHYNSVSHLHKMKKAAIDPSAPARGEGGAPPSAAAATDKPFKCTVCRVSYNQ
SSTLEIHMRSVLHQTRSRGAKADAKAEGPERSQEEPKEAEPDGLGGPEKKTTEPSGLVSG
LPFLSPPPPPLDLHRFPAPLFSPPVLPPFPLVPESLLKLQQQQLLLPFYLHDLKVGPKLA
LAGPTPVLSLPPPTPPAPAPAPPPKVEPAERERERPPVVEERSEVGPSSPPCQPANEAAR
TAAKALLENFGFELVIQYNEGKQPVPPPPAPPPPETLGGGDKLACGACGKLFSNMLILKT
HEEHVHRRFLPFEALSRYAAQFRKSYDSLYPSPAEPPKLPDGPADPSAPPLCPPFLGPEP
EAGSSQLPEEHLRLGGRWAQEEEDCGKGPIPPPAPAGRRFSRTKFTEFQAQALQSFFETS
AYPKDGEVERLAGLLGLASRVVVVWFQNARQKARKHAGDGGPVTVLGAGGGSLACRRCHA
AFSCIFELVRHLKKCYDDLPPEEEEEVGEEEEEAVEEEEPEEEQVAETPAGPEAPAPGSP
EGEDLCQAETTRPVGRETEGMSPGSPRLAHTCDQCAASFTSQELLSSHRRLHFVPPVPPG
APPHLLDLPLLVFGDRGPLVPGPPTASGPPLKRKHEEGSLSPTGSEAGGPGDGEPPRDKR
LRTTILPEQLEILYRWYMQDSNPTRKMLDCISEEVGLKKRVVQVWFQNTRARERKGQFRS
TSASVPSPAIKTPTPPTPVPFTKFGLLMGKVEDGVGREASKREALALPSAAASPSAGPAT
FLPTSKEASASLPDATPTPPLLPPPLEEEVPDEPLKASPETEVCSPSGGDLSDSSASSLA
EPESPGAGGGGGGGAGSGAGTPDGLGQRRYRTQMSSLQLKIMKACYEAYRTPTMQECEVL
GEEIGLPKRVIQVWFQNARAKEKKAKLQGVGGGGGGSGSEGPVGAPRTDCPYCDVKYDFY
VSCRGHLFSRQHLAKLKEAVRAQLKSESKCYDLAPAPEAPRVPKAPAPTTAATLPLGAAS
TLPRLAPVLLSGPALAQPPLSSLAPFSSGPAASSGLISLAAAASVLPATTVVQPSPARPL
PQRPDQTNSTTADPAPGPPVEASGDEVPDERKCAAAGVTTSSTDALKNLKALKATVPTLL
GGQFLPFPLPTAGGAAPPAVFGPQLQGAYFQQLYGMKKGLFPMNPVIPQTLIGLLPNTLL
QPPPQPPEPTATAPLKPPELHLPGEGEPGEADELLAGTTGISTVDVTHRYLCRQCKMAFE
GEAPAAAHQRSFCFFGRGPGAAVPPPLRVPICTYHCLACEVLLSGREALAAHLRSSAHRR
KAAPPTPPGGQPVPNATAFAKEEARLPHTDSNPKTTSTSTLLAL
Download sequence
Identical sequences F6UB49
XP_007479903.1.35504 XP_007479906.1.35504 XP_007479907.1.35504 13616.ENSMODP00000005230 ENSMODP00000005230 ENSMODP00000005230

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]