SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000005250 from Monodelphis domestica 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000005250
Domain Number 1 Region: 155-206
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000000177
Family Classic zinc finger, C2H2 0.0033
Further Details:      
 
Domain Number 2 Region: 571-602
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000000933
Family C2HC finger 0.02
Further Details:      
 
Domain Number 3 Region: 903-934
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000175
Family C2HC finger 0.015
Further Details:      
 
Domain Number 4 Region: 460-491
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000428
Family C2HC finger 0.02
Further Details:      
 
Domain Number 5 Region: 103-134
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000541
Family C2HC finger 0.026
Further Details:      
 
Domain Number 6 Region: 722-752
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000198
Family C2HC finger 0.016
Further Details:      
 
Weak hits

Sequence:  ENSMODP00000005250
Domain Number - Region: 192-235
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00191
Family Classic zinc finger, C2H2 0.035
Further Details:      
 
Domain Number - Region: 763-788
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0263
Family Classic zinc finger, C2H2 0.032
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000005250   Gene: ENSMODG00000004259   Transcript: ENSMODT00000005363
Sequence length 940
Comment pep:known_by_projection chromosome:BROADO5:1:695262329:695280858:1 gene:ENSMODG00000004259 transcript:ENSMODT00000005363 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
SPPMTLLVEEESCWLTKLPLVSSEADANSVIFRKDEAIWCKTTKPVPEAGLMNTFLMAEP
RGITSNPVKTEPGDPEYPATLHSDIQLLPQQAGMAAILATAVVNKDIFPCKDCGIWYRSE
RNLQAHLMYYCASRQSSGSPLVEEKPKETYPNERVCPFPQCKKSCPSASSLEIHMRSHSG
ERPFVCLICLSAFTTKANCERHLKVHTDTLSGVCHSCGFVSTTRDILYSHLVTNHMICQP
GSKGEIYSPSAAHLATKPGPTENLTSLQQHMALHGPLPTPDASQAPPGPESPTPPDSVAK
KAPDEAENGEAQAASQESCSSSSSASGEGAAPLLRIKEEVVEGQGTEPDMAKSHSQTEQG
TSPRSEPESSSRTSSPQSLASVKVKSELASPTPGSSPVPSEPGVGPAGGTIFLPQYMFGP
ETSVVPQASEILAKMSELVHSRLKQGHGGVAPALYPGTPAPKGATCFECEITFNNINNYY
VHKRLYCSSRHMAEESPPGARKPKVTAPPKGPPGPVVAPTRTILSPQPPEAEVKAEEAGG
GKEASPEADATGRGSEDSQSPRSSVDDPDEDPMKTVCEACNIRFSRHETYTVHKRYYCAS
RHDPPLRRPGGPHKVAFLPQPVRTRKRRKLYEIHAATSNAGLLPATHPQPPPPPPPPPPP
LGELPASPRLGPSVGKAPASVPSPSSSPDTDGPIDLSKKPRLHRPEGGPTAPPPPPPPPL
LPLTDYHECTACCVSFHSLEAYLAHKKYYCPAAPLPGGKPPPPVVCPYCPLNGTIKGDLI
EHFRHAHGLLVAKPVAGHVLAEANAPHTRTPAVASCGASSPQPGPRLPRDSFNGHELKEP
PAPANGSPLPTGSPRPGLPLSPATAPALTLSPVFEALLQPPTPPMYTDKGVQTPSKVTPA
PVPNGNHRYCRLCNIRFSSLSTFIAHKKYYCSSHAAEHVK
Download sequence
Identical sequences F6TVL0
ENSMODP00000005250 13616.ENSMODP00000005250 ENSMODP00000005250

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]