SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000005269 from Monodelphis domestica 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000005269
Domain Number 1 Region: 101-158
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 5.74e-25
Family Classic zinc finger, C2H2 0.0062
Further Details:      
 
Domain Number 2 Region: 299-356
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.04e-24
Family Classic zinc finger, C2H2 0.0072
Further Details:      
 
Domain Number 3 Region: 355-412
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 9.1e-24
Family Classic zinc finger, C2H2 0.0096
Further Details:      
 
Domain Number 4 Region: 439-494
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.75e-23
Family Classic zinc finger, C2H2 0.0053
Further Details:      
 
Domain Number 5 Region: 46-102
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.87e-23
Family Classic zinc finger, C2H2 0.0034
Further Details:      
 
Domain Number 6 Region: 244-300
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.56e-21
Family Classic zinc finger, C2H2 0.0064
Further Details:      
 
Domain Number 7 Region: 157-214
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 6.27e-21
Family Classic zinc finger, C2H2 0.011
Further Details:      
 
Domain Number 8 Region: 3-55
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.23e-17
Family Classic zinc finger, C2H2 0.0088
Further Details:      
 
Domain Number 9 Region: 402-434
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000000175
Family Classic zinc finger, C2H2 0.0095
Further Details:      
 
Weak hits

Sequence:  ENSMODP00000005269
Domain Number - Region: 485-513
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000288
Family Classic zinc finger, C2H2 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000005269   Gene: ENSMODG00000004279   Transcript: ENSMODT00000005383
Sequence length 514
Comment pep:novel chromosome:BROADO5:7:80725800:80727996:-1 gene:ENSMODG00000004279 transcript:ENSMODT00000005383 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
RFHTGEKHYRCNQCGKAFRNHANLGKHQRIHIGKKPLECHQCGKDFTQSYNLAVHQRIHS
GEKPYECHQCGKAFTESSAFASHQRIHTGEKPYEFKQCGKAFTQRNNLAAHQRIHTGEKP
YQCDQCGKAFTQRGHLAAHQRIHTREKLYECKQCGKAFTDSTKLSTHQRIHTGEKPYQCN
LCGKAFIQSSTLNKHHKSHAREEPFVCNQYGKAFIKSSSLRKHKRIHIGEQGMQQGSNNS
GEFFPQNSKLARHQRILSADNPYECNQYGKTFTESSNLVVHQRIHTGEKPFKCNRCGKAF
TQRGNLAVHQRIHTGEKPYQCNQCGKAFIHIATLPAHQRAHTGEKPYQCNQCEKAFTDSS
AFAAHQRIHTGEKLYKCNHCGKAFTQQNNLAAHQRIHTVEKPYQCNQCGKVFRQTSKLPA
HQRTHTGEKLFQCNQCGKVFTQRGHLTAHERIHTGKKPYECKQCGKAFTDSSKLSTHHRI
HTGEKPYECNECGKISHIAPHLFHKKIHTGEKPF
Download sequence
Identical sequences F6TEJ3
13616.ENSMODP00000005269 ENSMODP00000005269 ENSMODP00000005269

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]