SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000005280 from Monodelphis domestica 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000005280
Domain Number 1 Region: 562-619
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 4.9e-25
Family Classic zinc finger, C2H2 0.0062
Further Details:      
 
Domain Number 2 Region: 339-396
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 9.05e-25
Family Classic zinc finger, C2H2 0.0071
Further Details:      
 
Domain Number 3 Region: 11-70
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 1.12e-23
Family KRAB domain (Kruppel-associated box) 0.00091
Further Details:      
 
Domain Number 4 Region: 510-563
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.27e-23
Family Classic zinc finger, C2H2 0.0049
Further Details:      
 
Domain Number 5 Region: 283-340
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.45e-22
Family Classic zinc finger, C2H2 0.0055
Further Details:      
 
Domain Number 6 Region: 395-452
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.4e-22
Family Classic zinc finger, C2H2 0.0056
Further Details:      
 
Domain Number 7 Region: 437-489
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.94e-18
Family Classic zinc finger, C2H2 0.0091
Further Details:      
 
Domain Number 8 Region: 604-656
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 5.71e-18
Family Classic zinc finger, C2H2 0.0075
Further Details:      
 
Domain Number 9 Region: 246-297
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000000844
Family Classic zinc finger, C2H2 0.012
Further Details:      
 
Domain Number 10 Region: 191-233
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000074
Family Classic zinc finger, C2H2 0.017
Further Details:      
 
Weak hits

Sequence:  ENSMODP00000005280
Domain Number - Region: 494-517
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00119
Family Classic zinc finger, C2H2 0.0098
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000005280   Gene: ENSMODG00000004287   Transcript: ENSMODT00000005394
Sequence length 668
Comment pep:novel chromosome:BROADO5:4:406261274:406277778:1 gene:ENSMODG00000004287 transcript:ENSMODT00000005394 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDPGSRRPGGQVLVTFKDVAVDFTQEEWRLLDHSQKELYREVMLENAWNLHSVGLPISRD
HVISRFEQGEAPWILEREGPSSSCPDGETRLEMWPTTAKLSSSVKESEQQRLMTGGHFNL
NLGEICDFDIKREEKQKGRCESDGDGKSVRQYSVLIQSDKLTSENDCYQDSRYREFFIEQ
LELVESHEKPPELQTYQCNQCEMAFSLNSDLLRHEKSHTGAMLYICNEGEKAFSLNHQEI
PNGKNHYGYNECGKASKLQSSFVHHQRIHPREKSHECHEYDKAFSENSFFIVHQRSHIGE
KPFECNHCGKTFTKSTSLAEHQRIHTGERPFECNQCGKTFRFGSNLTRHQRIHTGEKPYE
CHQCGKNFRQRSNLAQHLRIHTGDKPYECNHCGKTFTKYANLTHHQRIHIGEKIFECDHC
GKTFTKHANLTQHQRIHTGEKPFDCSQCGKAFRCSLGLAVHQKIHTVEKTYECNQCGKTF
RFSSILTRHQRIHTEKSYKCNQCGKTLGNSSSLCKHRKIHTGEKPYECSQCGKSFRQRNN
LAQHQRIHTGEKPYECNQCGKSFRISSCLAKHQRIHTGEKPYECNQCRKSFRQISTLAQH
QRIHTGEKPYKCNQCGKSFRIRSRLAKHQRIHSGGKLYECNHCRNSFTTSSSRARHQRAC
PLNEFSDF
Download sequence
Identical sequences F6SY54
ENSMODP00000005280 ENSMODP00000005280

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]