SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000005331 from Monodelphis domestica 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000005331
Domain Number 1 Region: 735-792
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.62e-25
Family Classic zinc finger, C2H2 0.0035
Further Details:      
 
Domain Number 2 Region: 511-568
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.44e-25
Family Classic zinc finger, C2H2 0.0037
Further Details:      
 
Domain Number 3 Region: 399-456
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.94e-25
Family Classic zinc finger, C2H2 0.0055
Further Details:      
 
Domain Number 4 Region: 623-680
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.6e-24
Family Classic zinc finger, C2H2 0.0043
Further Details:      
 
Domain Number 5 Region: 567-624
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.8e-24
Family Classic zinc finger, C2H2 0.0058
Further Details:      
 
Domain Number 6 Region: 680-736
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2e-24
Family Classic zinc finger, C2H2 0.0038
Further Details:      
 
Domain Number 7 Region: 455-512
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.27e-23
Family Classic zinc finger, C2H2 0.0053
Further Details:      
 
Domain Number 8 Region: 344-400
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.38e-22
Family Classic zinc finger, C2H2 0.007
Further Details:      
 
Domain Number 9 Region: 247-307
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 9.82e-22
Family Classic zinc finger, C2H2 0.0044
Further Details:      
 
Domain Number 10 Region: 9-70
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 8.5e-20
Family KRAB domain (Kruppel-associated box) 0.00096
Further Details:      
 
Domain Number 11 Region: 301-353
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.02e-17
Family Classic zinc finger, C2H2 0.0078
Further Details:      
 
Weak hits

Sequence:  ENSMODP00000005331
Domain Number - Region: 228-254
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000188
Family Classic zinc finger, C2H2 0.021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000005331   Gene: ENSMODG00000004331   Transcript: ENSMODT00000005445
Sequence length 811
Comment pep:novel chromosome:BROADO5:4:404235151:404270004:-1 gene:ENSMODG00000004331 transcript:ENSMODT00000005445 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAPGTPRPPSQGSITLKDVAVDFTQEEWRLLDHSQKELYLEVMLENVQNLQTVGLPVPRE
IFLSCFQQGEAPWLLEQKGPRSSCPKAETTFDVEMSTKLSLFVEGCGPQRCMNEGPCDFI
SREICNSNNKANKTQKTDGEYDETTEKFSQYSALNHYMKLTSGNDCCQDNEYSTCFPAEL
ILIHSVQKPPEMPWYQGNLEGMAFGWSLDLIKHSNNKCVEMVSVNNKGGRSFSEYSELCS
HQIIHSGKKPYDCKYCGKTFTERGSLAAHQRIHTGEKPYECKQCGKAFTQRGQLTVHQRI
HLGEKPFICKHCGKAFTQRSHVVAHQRIHTQEKLYECKQYGKAFAERGQLIAHQRIHLGE
KPYECKHCGKAFSQRSHVAAHQRIHTQEKPYECKYCGKAFTVRDSLARHQRIHTGEKPYE
CKHCGKTFTDRSSLARHKRIHTGEKPYECKQCGKAFTLRGQLTAHQRIHTGEKPYECKHC
GKAFTQRGHLDKHQKIHTGEKPYECKQCRKAFTWRSSLAKHQRIHTGEKPYECKKCGKGF
TWWSDLIKHQRIHTGEKPYECKQCEKAFAETSSLARHQRIHTGEKPYECKQCGKAFTLRG
QLTAHQRIHSGEKPYECKHCGKAFTHSGHLDKHQRIHTGEKPYECKQCGKAFTWISSLAK
HHRIHTGEKPYECKQCGKGFTWWSDLTKHQRIHTGEKPYECKQCGKAFVERGHLSRHQRI
HTGEKPHECKHCGKAFTRRGHLARHQRIHSGEKPHECKECGKAFTWSSDLAKHQRIHTGE
KPYECKQCGKTFPWKVPCCPESENPHWQETL
Download sequence
Identical sequences F6X6H7
ENSMODP00000005331 ENSMODP00000005331

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]