SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000005462 from Monodelphis domestica 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000005462
Domain Number 1 Region: 16-257
Classification Level Classification E-value
Superfamily SET domain 1.05e-60
Family Histone lysine methyltransferases 0.00016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000005462   Gene: ENSMODG00000004437   Transcript: ENSMODT00000005580
Sequence length 301
Comment pep:known_by_projection chromosome:BROADO5:6:235992324:235998806:1 gene:ENSMODG00000004437 transcript:ENSMODT00000005580 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
ETGMSEEQPQASSGALRDVGRGLENLPISLWPEGEEPVFQYTPEPVMGPGAETDPTQITF
PGCACLTASCLPAACSCLLRGENYDHSCLRDIESEVEFARPMFECNVMCQCSEQCENRVV
KGLQFSLQVFKTDKKGWGLRTLDLIPKGRFVCEYAGEILGTLEARRRIQQQTKHDSNYII
AVREHICNGQIIETFVDPTHVGNVGRFLNHSCEPNLLMVPVRIDSMVPRLALFAAKDILP
NEELSYDYSGRFHNLTKKNGNQEMSDKHKIGKPCHCGTKSCAAFLPYDSSLYSPLENPTT
H
Download sequence
Identical sequences F6RTZ2
ENSMODP00000005462 13616.ENSMODP00000005462 ENSMODP00000005462

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]