SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000005522 from Monodelphis domestica 76_5

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSMODP00000005522
Domain Number - Region: 279-308
Classification Level Classification E-value
Superfamily beta-sandwich domain of Sec23/24 0.000209
Family beta-sandwich domain of Sec23/24 0.028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000005522   Gene: ENSMODG00000004484   Transcript: ENSMODT00000005640
Sequence length 459
Comment pep:known_by_projection chromosome:BROADO5:3:511923106:511924482:-1 gene:ENSMODG00000004484 transcript:ENSMODT00000005640 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
SSMHSPRYPSPAELDAYAQKVANSPLSIKIFPTNIRVPQHKHLSRTVNGYDTTGQRYSPY
PLHASGYQGLLAIVKAAVSSGSGSAPAAAGAASSSGKGVVKSVEGKRTKLSPAAVQVGIA
PYPVSSTLGPSAAPLGYHGGQKPLEGPAPPPNVTVAASVIPLAGRGLALPPSNLPSIQSI
IYQVNQQCQAQGSQPACQGVAVTHPSPAKRPTAATPAGFSGMAGSALAYASAMLPDCRKG
AELVVGATPAMALGGLKAAGYPDAGGGGGGAGLDYLLWQQKQQQQQQQQQQQQQQQQQQL
RMYSGGSGGGGAVSKSPEACGAAPRPYALGGAGDKVSSSPLNCVGMHGNFAVGPYFAPPW
NSILVTPNSDCYNPGPELGPGPRELAVHPAAADGLAGLPSKTVCNTSILSSSLQSLEYLI
NDIHPPCIKEQMLGKGYETVSVPRLLDHQHAHIRLPVYR
Download sequence
Identical sequences F6VRG3
ENSMODP00000005522 ENSMODP00000005522 13616.ENSMODP00000005522

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]