SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000005569 from Monodelphis domestica 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000005569
Domain Number 1 Region: 295-349
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.63e-23
Family Classic zinc finger, C2H2 0.0053
Further Details:      
 
Domain Number 2 Region: 183-239
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 4.67e-23
Family Classic zinc finger, C2H2 0.0077
Further Details:      
 
Domain Number 3 Region: 238-295
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.33e-21
Family Classic zinc finger, C2H2 0.0071
Further Details:      
 
Domain Number 4 Region: 2-54
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 1.44e-18
Family KRAB domain (Kruppel-associated box) 0.001
Further Details:      
 
Domain Number 5 Region: 350-399
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.05e-16
Family Classic zinc finger, C2H2 0.008
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000005569   Gene: ENSMODG00000004514   Transcript: ENSMODT00000005688
Sequence length 399
Comment pep:novel chromosome:BROADO5:1:692663655:692664982:1 gene:ENSMODG00000004514 transcript:ENSMODT00000005688 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LSQGSITFKDVVVDFTKEEWCLLDCSQKELCKEVMLENVQNLLSVGLTVPRKKNLSPVYS
KGNHNDCQRKKANGASVQRQRLILKEICNSDIKVNQNPMTNFEFDETAENFSQYSVLIQN
KKLTLGNDYSQDSEYSTCFPNEVGFIPLQDKPPEMLLHQDLIRHLKNKGIEMLSLNNKVG
GHFSKNSELGSHQRIHTGEKLFECKQCGKAFTQRGNLAIHQRIHIGEKPYEYKQCGKAFT
LRESLARHQRIHIGEKLFECNQYGKGFTKSYNLDRHQRIHTGEKLFECNQCGRGFTQSCN
LAIHQRIHTGEKPYEYKQCGKAFTQRSNLAIHQRIHTGEKPYECKQCKCFRTSSDLHKHQ
RIHTGEKPYDYEHDRKAFRSSSNLRKHQRIHTGQKSYEC
Download sequence
Identical sequences F6V923
13616.ENSMODP00000005569 ENSMODP00000005569 ENSMODP00000005569

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]