SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000005667 from Monodelphis domestica 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000005667
Domain Number 1 Region: 149-205
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.78e-27
Family Classic zinc finger, C2H2 0.0035
Further Details:      
 
Domain Number 2 Region: 204-261
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.6e-26
Family Classic zinc finger, C2H2 0.0026
Further Details:      
 
Domain Number 3 Region: 1-57
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 5.89e-21
Family KRAB domain (Kruppel-associated box) 0.0012
Further Details:      
 
Domain Number 4 Region: 112-162
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 8.92e-17
Family Classic zinc finger, C2H2 0.0062
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000005667   Gene: ENSMODG00000004588   Transcript: ENSMODT00000005786
Sequence length 261
Comment pep:novel chromosome:BROADO5:Un:7888584:7907561:1 gene:ENSMODG00000004588 transcript:ENSMODT00000005786 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTFQDVAVDFTREEWCLLSPPQKELYKEVMLENARNLLSVGLPVPTEDVLSYLEQSEAPW
MLEQEDLRSCHPDQQILMSDVPDNVAWREFCVESQNSPYSEHQRMNSEEKSSECEQSGKT
FRWRPKLAGHQRIHTGERSYECKQCGKIFSRRSNLIKHQRIHTGERPYECKQCGKTFSWS
SHLAQHQRIHTGEKPYECNLCGKTFTQSSTLARHQRIHTGEKPYECKQCGKTFSRSSYLA
QHQRVHTGEKLYECKQCGKTF
Download sequence
Identical sequences H9H654
ENSMODP00000005667 ENSMODP00000005667

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]