SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000005747 from Monodelphis domestica 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000005747
Domain Number 1 Region: 269-343
Classification Level Classification E-value
Superfamily Homeodomain-like 4.71e-21
Family Homeodomain 0.00087
Further Details:      
 
Weak hits

Sequence:  ENSMODP00000005747
Domain Number - Region: 143-150,221-245
Classification Level Classification E-value
Superfamily Formin homology 2 domain (FH2 domain) 0.00497
Family Formin homology 2 domain (FH2 domain) 0.085
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000005747   Gene: ENSMODG00000004664   Transcript: ENSMODT00000005868
Sequence length 486
Comment pep:known_by_projection chromosome:BROADO5:2:131394676:131403899:1 gene:ENSMODG00000004664 transcript:ENSMODT00000005868 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MFAAGLAPFYASNFSLWSAAYCSPAGAAGCSFPLDPAAAKKPSFCIADILHAGVGEPGAA
AESLSGGSSTALTAHLGAVHPHAPFQAATGSPLRPTPVVAPPEVPTAFPQRLSPLSAAYH
HHHHHQQPQQQQQQPQQQQQQQPPPPPPPPHRPGALQSQAPGARMLGNPHHHSGSTPAPS
SKDLKFGIDRILSAEFDPKVKEGNTLRDLTSLLTTGRQTGLHLPALQPSAGHFFASLDPI
NEASGILSPLNSNPRSSVQHQFQDTFPGPYAVLTKDTMPQTYKRKRSWSRAVFSNLQRKG
LEKRFEIQKYVTKPDRKQLAAMLGLTDAQVKVWFQNRRMKWRHSKEAQAQKDKEKDPAEK
LPGGAPTAECEREERSPSRSEGESESSDSEFLDMAPSDTERTEGTEQLLHQTSVIKPSPS
SSSTSSSSTNPNTTTTTTTTTTTTSSSGSSNSMNSVNSSCSPELQTSLPLHCTANESLEP
APLGGL
Download sequence
Identical sequences F6U7F3
ENSMODP00000005747 ENSMODP00000005747 XP_001375887.1.35504

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]