SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000005786 from Monodelphis domestica 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000005786
Domain Number 1 Region: 9-69
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 5.49e-22
Family KRAB domain (Kruppel-associated box) 0.001
Further Details:      
 
Domain Number 2 Region: 221-280
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.05e-20
Family Classic zinc finger, C2H2 0.0043
Further Details:      
 
Domain Number 3 Region: 276-337
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 8.27e-20
Family Classic zinc finger, C2H2 0.0043
Further Details:      
 
Domain Number 4 Region: 343-383
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000000046
Family Classic zinc finger, C2H2 0.012
Further Details:      
 
Domain Number 5 Region: 189-234
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000000115
Family Classic zinc finger, C2H2 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000005786   Gene: ENSMODG00000004696   Transcript: ENSMODT00000005909
Sequence length 383
Comment pep:novel chromosome:BROADO5:4:276698504:276699825:1 gene:ENSMODG00000004696 transcript:ENSMODT00000005909 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
IAPRTQRTPSQSSLTFKDVAVDFTQEEWCLLDHSQKELYLKVMLENVQNLFSVGLPVPRE
YFTSCFQQGKATWLLEQKSLRNSCPEAETNFEMKEFSTKLRIFVEESDPKRCTNEDSHNF
ILREICDSDIKINKNVKSEYEFDNPSEKFSQYSVLNQCVKLSSGNVCCQDSQYSKCFPED
LGLFHWNEKPSKKKNPCIKDEGGKPFSQNSDLAPHQIIHSGEKPYECKQCGKAFNEGTLA
IYHRIHSGEKPYECKQCGKTFTQGSHLNKHQRIHSGKNPHECKRCGKAFTQRILLHAHQS
IHTGEKPYECKQCGKAFKWNFSLAAHQRIHTAEKPYKYSYGNAFSERGSLVKHQKIHTGV
KSYECKQCGKTFTERGYLSKHQR
Download sequence
Identical sequences F6TQQ1
ENSMODP00000005786 13616.ENSMODP00000005786 ENSMODP00000005786

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]