SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000005845 from Monodelphis domestica 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000005845
Domain Number 1 Region: 388-454
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 0.000000000000244
Family PHD domain 0.0026
Further Details:      
 
Domain Number 2 Region: 1021-1080
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 0.000000000000332
Family PHD domain 0.0035
Further Details:      
 
Domain Number 3 Region: 969-1027
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 0.0000000000642
Family PHD domain 0.012
Further Details:      
 
Domain Number 4 Region: 1093-1160
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 0.000000000946
Family PHD domain 0.018
Further Details:      
 
Domain Number 5 Region: 346-405
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 0.00000000215
Family PHD domain 0.0086
Further Details:      
 
Domain Number 6 Region: 472-528
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 0.000000182
Family PHD domain 0.029
Further Details:      
 
Domain Number 7 Region: 16-25
Classification Level Classification E-value
Superfamily Formin homology 2 domain (FH2 domain) 0.00000942
Family Formin homology 2 domain (FH2 domain) 0.13
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000005845   Gene: ENSMODG00000004745   Transcript: ENSMODT00000005968
Sequence length 1575
Comment pep:novel chromosome:BROADO5:8:217242034:217500387:-1 gene:ENSMODG00000004745 transcript:ENSMODT00000005968 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSSEEDKSGEQPQPPPPPPPPPPPPPPEEPGAPAAPSPAAADKRPRGRPRKDGASPFQRA
RKKPRNRGRTAVEDDDSMDGLETAETENTVETEVKEQSAEEDGETELDSSKQLTPALQRS
VSMESSSSTVSVGVEAKIREQLCAFCYCGERSSLGQGELKQFCPTPEFIIPWKKQPLNKK
DTDDNSDGTNDKTQYPVPRKQRGQRKERSPRQSITSYVNVSTQTASDDQTGKLWDELSLV
GLPDDIDFQALFESTGHFWAHHRCAEWSLGVCQAEEQALMNVDKAVVSGSTERCAFCKHL
GATIKCCEEKCTQMYHYPCAAGAGTFQDFSNFSLLCPEHIDQAPERSKEEANCAVCDSPG
DLVDQFFCTTCGQHYHGMCLDIAVTPLKRAGWQCPDCKVCQNCKHSGEDSKMLVCDTCDK
GYHTFCLQPIMDSVPTNGWKCKNCRICAECGTRTSSQWHHNCLVCDSCYQPQDNLSCPFC
GKCYQPDLQKDMLHCHMCKRWIHIECDKPADTELDSQLKEEYVCMYCKQLGDMDPVQPCD
EMETSELIPQPVTDSVNEMETEKPDEGLAFLDQAVKSNSVHQELIPEIVPVAVHEGEEEL
TNIKNDNSSERLITGSPLIPDPTHDKLNADVQNEVSHQADEDEMETSDKMVEAIYDESQN
QNKMEVTENDFTLTKMKVSQNEEEPQALQESHTAGPIEESPSPQLTPENITAVSEVSPSI
CIEKTVLITTNELGIEKFQGEIEKDEISEVSSSIVEMESVPSFDSCLKVSSPPEEKLIKS
PSETDSAFSSTADISKRNMCSPSLVSLDLTSTNDMLHNEPSNLHCSAGNIMPTTYISVTP
KIGMGKPAITKRKFSPGRPRSKQGAWSTNNTVSPPSWSPDISEGRDIFKPRQLTGSTIWS
IKVGRGSGFPGKRRPRGAGLSGRGGRGRSKLKSGIGALVLPGVTSMDILSCKDEEENSMH
NTVVLFSSSDKFTLHQDMCVVCGSFGQGAEGRLLACSQCGQCYHPYCVSIKITKVVLSKG
WRCLECTVCEACGKATDPGRLLLCDDCDISYHTYCLDPPLQTVPKGGWKCKWCVWCRHCG
ATSPGPRCEWQNNYTQCAPCASLSICPVCCRNYREEDLILQCRQCDRWMHAVCQNLNTED
EVENVADIGFDCTMCRPYIPTANVPSSDCCESSVVAQIVTKVKELDPPKTYTQDGVCLTE
SGMSHLQSLTVTVPRKKRSKPKLKLKIINQNSVAVLQTPPDIQSEHSRDGEMDDSREGDL
MDCDGKSDSSPEREAVDDDPKGVEGTDGIKKRKRKPYRPGIGGFMVRQRSRTGQGKTKRS
LTRKDSSGSVSEHLPVRDDGWNEQLPDTLVDESIPISDSTEKIKKRYRKRKNKLEETFPA
YLQEAFFGKDLLDTIRQNKLCLDNLSEESASQLPCKTNMNTNFLDPSSDPLLSSTSTPVK
PGTQGNADDPLADLSDVLNTEDDILGILSDDLVKSADPSGLDLCTFQVENSPSPFAGLDI
GSISDDPSSLPQPNVNQSSRPLSEEQLDGILSPELDKMVTDGAILGKLYKIPGMCSCSCF
LNLLFPIIRPPIHIF
Download sequence
Identical sequences F6XJA7
ENSMODP00000005845 ENSMODP00000005845

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]