SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000005971 from Monodelphis domestica 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000005971
Domain Number 1 Region: 239-286
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000246
Family Classic zinc finger, C2H2 0.019
Further Details:      
 
Weak hits

Sequence:  ENSMODP00000005971
Domain Number - Region: 142-188
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0119
Family Classic zinc finger, C2H2 0.028
Further Details:      
 
Domain Number - Region: 208-233
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0271
Family Classic zinc finger, C2H2 0.022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000005971   Gene: ENSMODG00000004851   Transcript: ENSMODT00000006097
Sequence length 1506
Comment pep:known_by_projection chromosome:BROADO5:1:75298406:75302967:-1 gene:ENSMODG00000004851 transcript:ENSMODT00000006097 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPSEQKQFFCDEKPTTLEKGYDVEDIIVIDAVESEEPRILEDNSLYELKNVKIDLPKISI
SDETPLTHEVDTYKQVFESKPQTARKSVGKEKINESPLTCSMLLRPNVRFEEEGMKMSAK
ILNFSCTKCRDNVRYSPNDLQKHFQLLHCGELPLYPCEMCSFSANDFQSFKQHRLIHRST
LVKCDICNDENVYTLLDLTKHFAVKHCVNGNFQCEKCKFSTKDVGTFVQHIHRHNEIHYK
CSKCNHISFTKGEFQQHLFVHSTTFPFSCQYCNYSAAEKDQLVKHVVALHKDQLYAKDKL
EKEKCEKRIVKTTAGLKLILRRYKIGTSRKTLWRQKKENNGNDSYVEKNTEVLKNINKIQ
FKSEEQSNIQEHLNEEKNDTIHIEKPSQKQDESESETRNLLPTSQSSRSEEGSSSGFGFL
KNVIHGPAVLMLKNNKISVPANYSAKFMGFKMVDGKQHIVIKLLPTNKSNSCSPGLQPGT
IKDNTTDVQHRTAETTGLPTGATLHTSELNNTICTNTSNPLSFSTPLFSGNGTSEKEKTV
LAQTRSKSQTVGAEKSTPLLSTNSELTAAPLNLTTKIRISNNVGAWGSCVIQSHPQVLCA
TVKNPVNVESVEVNSVEPKAQHSGILNNSSINDLNYMPFSGQGSLPFHNYSKMDYLDNSC
SISATAHENSEESSSSKTAVHQYSSRSESGLSSVGMSPNPDLHETSPSKIYTCEPLKNQC
EDTEILETIQNIDTQNPQADINQGLEDVAEKSDWENISCVDSFTMPKITSVFSLQSTQAS
DFWSPEETQLLQNVLDEKLSLGKDSDITPNKGVQLHDEPLLKNEGKSNITEYLKGSESPC
TLPISSSNVGISVHTKDLNANNCTANTEMGCGKEKQVLSTSNDLGDSEKIPRIAVVDSVK
TQSDTRITQQLVKDKIQATPDSSNGLGSFHVLSPPINSEPKKAIFVQSSPKGFILPLHLA
SKSGLKLVSGRSLSSTNPPGILMTKGIPSSLLLNKKPGMILRLSNGVLGSVTNITGENSQ
VLGGAIAKEDDKTPSVRADLKKDSPTNIICSSTFDSRPDMAVSSENSIPFKGSYIFRNPA
ESSVNENSSQNTVPGCQSTKSQSLGSVRQPSEAQQKQSLYALLPDGRQAVLLRCVTPSKS
QVGPSDLLQNSTYDHQNHQPKKSGATQQKILLKIIKNPAFDNSQSAKSPKSSLQLDIIQS
HQTSTAEEKQLVSSSDALLLTNRLMPANATVTTSTAICNIPPQGTVCTTTHPETQLLRCQ
TNSSFRSGFNHGKSTRRQISKMKAHVQHKASESMITYENRNFGPKCRDNFQEWPRKKVML
HRKSKRKTKSEDFHDTFDLYRPRFPKDTVRTLRLFPFSSTQLIKCPRRNQPVVVLNHPDT
DSPEVVNVMKTIAKFKGQVVKVSLSKRTIQALLEPAYCNISKAVTDYFSAKRHKVLKPVK
ERFVLKLTLKKTSKNNYQIVKTTSDNTLKAKFNCWYCGRVFDNQDAWVGHGQRHLMEATR
DWHMLE
Download sequence
Identical sequences F6U4M8
13616.ENSMODP00000005971 ENSMODP00000005971 ENSMODP00000005971

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]