SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000005994 from Monodelphis domestica 76_5

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSMODP00000005994
Domain Number - Region: 126-407
Classification Level Classification E-value
Superfamily Formin homology 2 domain (FH2 domain) 0.00149
Family Formin homology 2 domain (FH2 domain) 0.022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000005994   Gene: ENSMODG00000004872   Transcript: ENSMODT00000006121
Sequence length 1613
Comment pep:known_by_projection chromosome:BROADO5:2:457681726:457795855:1 gene:ENSMODG00000004872 transcript:ENSMODT00000006121 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MVKSLSSEGEKPDTEGGGSATAAQIRDKGIQTPGSSISTGMVSNWTDSGPSGYLRRCPSS
VHCRVPMSVQRSPPAPASKTPPAPLQVSALDLAVPLTEGRAPSALGWGIEGGATAPFYWE
PNIFSPPPPPPPQSPPAKANCQVDPASLEYYKKENEEENLLANVTSLRNELNRTEWSLQN
LGEELSIPADNSESSIHLTRFERLSVDDLVQPLYSGPGPHKTVGKITYSNSDLQRKSRDK
SYVASSVTNPSVDQENRGLREKLNKLRQHNASLISQNHALMNKIESLNFELTQSRTKICV
LEATQSQNFSIPILEEQIINLEAEVSAQDQVLREAEDKLEQSQKTVIEKEQSLQKTKEEC
SKLKLDLLEQNKQGKRVEQQRNEAMHNAEGLSKAFKQYKEKVAEKLERVQAEEALLEKNL
VNCEKENKRLQEKCVMYRGELESMKEKLRELKDENNNGKERIRGMILKNSEIMSQLSESK
QNILKLESALEDKEEILREKLALVNENRELKALIAKQNERLILCQREIEDSRQELSSLEI
IISQLPFNREMLNSKTCICKQQEEMFSTKEEFCVSCCELNKSVISNLRIKLAMKEAEINK
LQTSLSTCQFSGHFFGDDEMQECGKLSGLETEPVKLSGNQANHIQCQKLHTVSKHFEREK
QRLAAGIEELRAKLAKTESENSELKADMAHRTSQFQVIQEELLEKVTSFSKMESEMTRKC
SQILTLEKQLEEKTIAYSSVAAKNSELEQELVEKNEKIQSLESDMNSKHEKICLAFEKAK
KIHFEQHKEMEHQIELFQIQLEKKDQQFKEQEKTVSILQQDIVCKQHHVESLDRLLLEKR
GEMEKQNIKKDESLKMLQNQVSEEAMKVRQLESALDICKEELAVHLNQLEGNKEKFEKQI
KKKSEEVYCLQKELKLKTHSLQETAKQNVILQHTLQQQQQMLQDETLRNGELEDVQAKLE
KQVTFMSNQIKMRKQEQQKSLTMESYYVSYFSAITIRALKICLLLPLALHIKLEMDQCKD
ELIQMEKEILHLRRDGDNKAVQLNHLDMTLEQTQTELDKKVKAVKELEKLQHQYQKDLKE
ALQKREELESELQNAHIELKNTLKQLQELRGVLQNAQISLEEKYSTIKDLTAELRECKLD
IEDKKQELLSMDQALKDRNWELKQRAAQVSQLDVTIREHRGEMEQKIIKLESSLEKTKLE
LKESNKQKEVLEEDLHISKDQLREKEFEILQNEQEISQLKKETERKQQKISEIENIVKEQ
EQCIAAQYKEALDLGKQVRLAEEQIQQTQQELLETRRQQIQAQRETERLANELEETKHLS
REKEVHANHLAEELGASQVRETQMEARLQTEVKKLLSEIESLKEVYHLEMLTHRENRTKW
KVSSDSQKSSVHQLNIQLEKAKQELEETQDTLSNLHKQVQDKNEVIQAANEALLVKESEV
TRLQAKLSGRERSEGLKHLPASFLSPTEIMYNIQDARVFKHPHPSLYKSRKLRRSISASD
LSFKTIDNEDLSEELIDDLKQALIQNPLPTEENKKDALYTPSDLLVSLTYDADEDEASQS
NDFSTLSGMLKYINKEVKLSKRSSVSAFGTNQFHRGRVKKMAKSQRHRREMEG
Download sequence
Identical sequences F6TN60
ENSMODP00000005994 ENSMODP00000005994

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]