SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000006131 from Monodelphis domestica 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000006131
Domain Number 1 Region: 343-403
Classification Level Classification E-value
Superfamily Homeodomain-like 7.52e-22
Family Homeodomain 0.0004
Further Details:      
 
Weak hits

Sequence:  ENSMODP00000006131
Domain Number - Region: 119-127
Classification Level Classification E-value
Superfamily Formin homology 2 domain (FH2 domain) 0.00157
Family Formin homology 2 domain (FH2 domain) 0.13
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000006131   Gene: ENSMODG00000000438   Transcript: ENSMODT00000006260
Sequence length 434
Comment pep:known chromosome:BROADO5:4:122517413:122524707:1 gene:ENSMODG00000000438 transcript:ENSMODT00000006260 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEEQQPEHNSQRDSTIGTASHSSSSSSASSSSGSSSSSSSSGSNSNSSSSSSSGSSSGSS
SGSDGDSVPVSPQQAPSSPAAPCLQPLPHHHHHHHHHHHHHHHQPPPPPQPMPAPPHQPP
PPPPPPPQQHRTTNFFIDNILRPDFGCKKEQQQQQQLLVGAGGGGGGGSAVAAAGGGGGG
GGGGGGRAERDRGQTAAGRDPANPLGTRPGNPGSLLCSADANCVTPDGSAPAPAAAASKA
NPAAAAAAAAAAAAAVAAAAAAAAAASKPSEGSGGSPGATGAKYGEHGNPAILLMGSANG
GPVVKTDSQQPLVWPAWVYCTRYSDRPSSGPRTRKLKKKKNEKEDKRPRTAFTAEQLQRL
KAEFQANRYITEQRRQTLAQELSLNESQIKIWFQNKRAKIKKATGIKNGLALHLMAQGLY
NHSTTTVQDKEESE
Download sequence
Identical sequences F7FKR9
ENSMODP00000006131 ENSMODP00000006131 XP_007494128.1.35504

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]