SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000006132 from Monodelphis domestica 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000006132
Domain Number 1 Region: 358-409
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000000000567
Family Classic zinc finger, C2H2 0.0089
Further Details:      
 
Domain Number 2 Region: 278-329
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000000904
Family Classic zinc finger, C2H2 0.028
Further Details:      
 
Domain Number 3 Region: 247-288
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000889
Family Classic zinc finger, C2H2 0.015
Further Details:      
 
Domain Number 4 Region: 322-361
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000069
Family Classic zinc finger, C2H2 0.025
Further Details:      
 
Domain Number 5 Region: 62-94
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000942
Family Classic zinc finger, C2H2 0.031
Further Details:      
 
Weak hits

Sequence:  ENSMODP00000006132
Domain Number - Region: 490-514,548-573
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000189
Family Classic zinc finger, C2H2 0.031
Further Details:      
 
Domain Number - Region: 411-476
Classification Level Classification E-value
Superfamily Expressed protein At2g23090/F21P24.15 0.00085
Family Expressed protein At2g23090/F21P24.15 0.011
Further Details:      
 
Domain Number - Region: 13-52
Classification Level Classification E-value
Superfamily SET domain 0.0785
Family Histone lysine methyltransferases 0.084
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000006132   Gene: ENSMODG00000004979   Transcript: ENSMODT00000006261
Sequence length 882
Comment pep:known_by_projection chromosome:BROADO5:4:280079261:280147644:-1 gene:ENSMODG00000004979 transcript:ENSMODT00000006261 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MMFVRPAQNHLEQNLVAYQYGHHVYYTTIKNVEPKQELKVWYAASYAEFVNQKIHDISEE
ERKVLREQEKNWPCYECNRRFISSEQLQQHLNSHDEKLDFFSRARGRGRGRGKRRFGPGR
RPGRPPKFMRLEVTNENGEKCEEATQDLLPFPSKALEKFDEDGPAPLNGLDQQEQTPVPI
PQLTPETQPALEHPPETHPVHLQPPHEESSVPTQSTMTADDMRRAKRIRLELQNAALQHL
FIRKSFRPFKCLQCGKAFREKDKLDQHLRFHGREGNCPLTCDICNKGFISSSSLESHMKF
HSDQKTYSCIFCPESFDRLDLLKDHVAIHINDGYFTCPTCKKRFPDFIQVKKHVRSFHSE
KIYQCTECDKAFCRPDKLRLHMLRHSDRKDFLCSTCGKQFKRKDKLREHMQRMHNPEREA
KKADRISRSKTFKPRIASTDYDSFTFKCRLCMMGFRRRGMLVNHLSKRHPDMKIEEVPEL
TLPIIKPNRDYFCQYCDKVYKSASKRKAHILKNHPGAELPPSIRKLRPAGPGEPDPMLST
HTQLTGTIATPPVCCPHCSKQYSSKTKMVQHIRKKHPEFAQLPNTIHAPLTTAVISATPA
VLTTDSATGETVVTTDLLTQAMTELSQTLTTDYRTPQGDYQRIQYIPVSQSTTGLQQPQH
IQLQVVQVAQATSPHQSQHSTVDVGQLHDPQTYTQHAIQVQHIQVAEPTTPAPSSSQVAG
QPLSPSAQQSQPGLSPSHMQTNSSAQGQTLQQQQQQSSSVQHTYLPNTWSSFRSYPSELQ
MMAIPQGQYVIAETAVTTPVTTVNTGQVKAVTQTHFVISEGQPEIEEKQTSALSSAVQVG
VSQQSTHADALESQTTNPPQTTQYIITTTNGNGNSEVHITKT
Download sequence
Identical sequences F7FKR5
ENSMODP00000006132 ENSMODP00000041264 ENSMODP00000006132

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]