SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000006207 from Monodelphis domestica 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000006207
Domain Number 1 Region: 335-392
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.02e-25
Family Classic zinc finger, C2H2 0.0029
Further Details:      
 
Domain Number 2 Region: 451-505
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.25e-24
Family Classic zinc finger, C2H2 0.005
Further Details:      
 
Domain Number 3 Region: 280-336
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.3e-22
Family Classic zinc finger, C2H2 0.0066
Further Details:      
 
Domain Number 4 Region: 379-441
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.89e-22
Family Classic zinc finger, C2H2 0.0026
Further Details:      
 
Domain Number 5 Region: 37-89
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.44e-17
Family Classic zinc finger, C2H2 0.0077
Further Details:      
 
Domain Number 6 Region: 237-289
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.02e-16
Family Classic zinc finger, C2H2 0.0064
Further Details:      
 
Domain Number 7 Region: 155-214
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.08e-16
Family Classic zinc finger, C2H2 0.0046
Further Details:      
 
Domain Number 8 Region: 90-140
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000000000081
Family Classic zinc finger, C2H2 0.0059
Further Details:      
 
Domain Number 9 Region: 1-46
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000000000163
Family Classic zinc finger, C2H2 0.0084
Further Details:      
 
Weak hits

Sequence:  ENSMODP00000006207
Domain Number - Region: 208-238
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00437
Family Classic zinc finger, C2H2 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000006207   Gene: ENSMODG00000005045   Transcript: ENSMODT00000006337
Sequence length 505
Comment pep:novel chromosome:BROADO5:2:256351823:256393325:-1 gene:ENSMODG00000005045 transcript:ENSMODT00000006337 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MCNECGKIFHQSSDLIIHHRLHTGENPFECYDYGKTFSHSSYLVHHTGKKFYKCNECGKA
FRQHSRLTKHQRIHSGEKPYECKECEKTFNLLRHCIIHTGEKYECYECGKAFSQRSYLVI
YHKIHTRKKPYEYNECGKAFRQPSLLPQHKRSVAKPYEYNQCGKTFIWHTTFLKHKRIHK
NSMPHECSECGKIFSQNSYLVSHQRIHTGEKPYKFNECERAFSQKKKSEFNEYQKSHTLK
RAHECNECRKVFSRGSNLTIHQRIHMGKKPYICDECGEGFNQSSNLCRHQRIHSGENPYE
CHECGRAFKGSSNLILHQRIHSEGKPYVCKECGKAFSQSSHLVAHKRIHTGEKPYECNEC
GKTFRQSSLLIQHQRIHSGEKPYRCHKCGKAFSGAHSDLIRQQITHTGEKPYECNECGKA
FSQNSILIEHQRIHLGEKPYKCSKCGKALRRSSQLIQHQRIHSGKKPYECNECGKTFNQS
SALNRHHRIHSGEKPYECNKCGKAF
Download sequence
Identical sequences F7BEQ5
13616.ENSMODP00000006207 ENSMODP00000030989 ENSMODP00000006207

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]