SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000006250 from Monodelphis domestica 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000006250
Domain Number 1 Region: 7-126
Classification Level Classification E-value
Superfamily POZ domain 1.46e-33
Family BTB/POZ domain 0.00061
Further Details:      
 
Domain Number 2 Region: 397-449
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.16e-16
Family Classic zinc finger, C2H2 0.0078
Further Details:      
 
Domain Number 3 Region: 449-505
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000232
Family Classic zinc finger, C2H2 0.03
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000006250   Gene: ENSMODG00000005080   Transcript: ENSMODT00000006380
Sequence length 616
Comment pep:novel chromosome:BROADO5:4:280545418:280599288:-1 gene:ENSMODG00000005080 transcript:ENSMODT00000006380 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGVKTFTHSSPSHSQEMLGKLNMLRNDGHFCDITIRVQDKIFRAHKVVLTACSDFFRTKL
VGQAEDDSKNVLDLHHVTVTGFIPLLEYAYTATLSINTENIIDVLAAASYMQMFSVASTC
SEFMKSSILWNTPNNQQEKGLDAGQENSSNCNFTSRDGSLSPVSSECSVVERTIPVCRES
RRKRKSYIVMSPESPLKCSTQTSSPQVLNSSASYSEPRNQPVDSSLSFPWTFPFGIDRRL
QSEKVKQVENPRTLELPGPSEAARRMTDYMTCESTKANLPLVTEEDVRVKVERLSDEEVH
EEVSQPVSASQSSLSDQQTVPGSEQIQEDLLISPQSSSIGSVDEGVTEGLPTLQSTSSTN
THADDEDRLENVQYPYQLYIAPSTSSTERPSPNGPDRPFQCPTCGVRFTRIQNLKQHMLI
HSGIKPFQCDRCGKKFTRAYSLKMHRLKHEGKRCFRCQICSATFTSFGEYKHHMRVSRHI
IRKPRIYECKTCGAMFTNSGNLIVHLRSLNHEASELANYFQSSDFLVPDYLNQEQEETLV
QYELGEHSFESNSSVQMPVISQVSSTQNCESTFPLGSLSGLTEKEEEMPEQPKTSASSET
IRDDPPKLELSSITIE
Download sequence
Identical sequences F7A4N4
ENSMODP00000006250 ENSMODP00000006250 XP_001373788.1.35504 XP_007495195.1.35504 XP_016277316.1.35504

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]