SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000006361 from Monodelphis domestica 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000006361
Domain Number 1 Region: 199-256
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3e-26
Family Classic zinc finger, C2H2 0.0063
Further Details:      
 
Domain Number 2 Region: 146-200
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.51e-22
Family Classic zinc finger, C2H2 0.01
Further Details:      
 
Domain Number 3 Region: 1-46
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 4.32e-21
Family KRAB domain (Kruppel-associated box) 0.0014
Further Details:      
 
Domain Number 4 Region: 241-290
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.3e-16
Family Classic zinc finger, C2H2 0.0048
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000006361   Gene: ENSMODG00000006445   Transcript: ENSMODT00000006493
Sequence length 290
Comment pep:novel chromosome:BROADO5:Un:14679317:14687073:-1 gene:ENSMODG00000006445 transcript:ENSMODT00000006493 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
QESLTFKDVAVEFTWEEWRHLDPAQRALHRNVMLENYENLVSIGKQNNALGDVQNEEGEA
GTGACIGHLLKSKRNSLKLKEAHERTESTDGQSEKERLNVETTLRSLSSKGKIRLEMKEM
TAELSLSGEETQRQRCIGDGACDSTWRENLDVHQRIHTGEKRFECNHCGKAFRSRNRLVT
HQNVHTGEKPYECNQCGKVFTYESRLNVHQRIHTGEKPFKCNQCGKAFTHKSGLTVHQRI
HSGEKPYECNLCGKAFSQKSSLTVHQRIHSGEKPYDCYRLSKILSQKSTL
Download sequence
Identical sequences H9H659
ENSMODP00000006361 13616.ENSMODP00000006361 ENSMODP00000006361

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]